CAZyme Information: MGYG000001483_01944

Basic Information

• Species: Arachnia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Arachnia; Arachnia massiliensis
• CAZyme ID: MGYG000001483_01944
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	MGYG000001483_18|CGC8	29086.23	4.136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001483	3211248	Isolate	not provided	not provided

• Gene Location: Start: 528315; End: 529124 Strand: -

Full Sequence      

MNRVRGQWLAVAAALAVGLPGCAAETPELPADTGFDYQLSGAYPPPAGAGILVRDRSATP
HPMAYNVCYLNGLQAQPEELAWWEAEHPGLLLRGDDGAPVIDEQWDEALFDVSSWAKRDA
LLEVQRGWIDACAEAGFDAVEFDNQDSWIRSAGALDLDDALTHLATLTGYAHGLGLAVAQ
KNQGPELGARGRDEVGFDFAIAEECAVWDECDSYIDVYGDQVLQVEYTDQPSGPFVDSCA
RWKGHHPIIRRDRGLVAPGEPGHHYAACG

Enzyme Prediction     

No EC number prediction in MGYG000001483_01944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	62	227	9.6e-37	0.8105263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03537	Glyco_hydro_114	2.17e-44	34	255	1	219	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG3868	COG3868	0.005	101	231	132	268	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGU27895.1	1.48e-77	1	268	1	287
QIT13580.1	4.34e-76	30	268	60	295
QIT10437.1	2.18e-75	30	268	56	291
AFR08640.1	2.65e-75	1	268	1	275
QIQ06654.1	4.26e-75	35	268	37	265

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000409	0.291730	0.707183	0.000356	0.000190	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001483_01944.