CAZyme Information: MGYG000001483_03036

Basic Information

• Species: Arachnia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Arachnia; Arachnia massiliensis
• CAZyme ID: MGYG000001483_03036
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		89601.39	4.3758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001483	3211248	Isolate	not provided	not provided

• Gene Location: Start: 940019; End: 942598 Strand: -

Full Sequence      

MVSKKTRIASVVAASALAAGGIVIPNYVAHGDPAVVIPAGAIELQDYDFKVRLHPDFPQV
VDYRLGDEQLAGRIGGPLTSMLVNGQSQTVTVAEAVVGHGQKSATYAVSFPNLAGVTLTV
LAEVEDRVLRLTLTDLVDPESRIQSIQIPNHDLVTLGSTDAAAQLTTARVAAGTQAGGDT
FQKLAGSTAGSAQGSSLVLANTSSLAAAFATNAVGTAANGTWQHQIRTSGHNRLGAVSAG
TWTGVAGAEPYVEVKVVADENGDGTVDWQDAGVAAQSIIALGNGAEEVANEVIARAPSGS
FAQAQADTAAISAATENLGQRVVLEGVTADADGLEAMSDAGVALNSTFGYDVAVAGATAG
AFQSLWDNGPVNVDTLYFDQALDTPAQQQLNAALQEQGWVVSTHPLANTGADSDVIRFVY
NAARDGWNDDPILGAAQFVDFGDDAFYTNVWENNLPAKFLQRSDLTDRDATTAKFANGTV
ATATEVTYGDVTVAKDGAYLLPWCDGGSEWNDEGPKRLYHYNPAGGATTWTLTEEFAADT
SFTQFSLTDQGRALVREVKAASGAITIQALPGTAYVLFPTSEAPTAGNLPPAEFTVEDAA
AKVGTPVSIQVQTTDPEEGELTYSATGLHAGLAINAGTGAITGTPTKAGTYHVTVTAKDA
AGASASATLTITVAPKDSTTPPTTPPPTTPPATTQPPSTPPATKPAVEKFVPQAPYTLPG
LHKGLNGRDWMTKCEPYSQTERCRTDIWATVVLIENGQFVRKSGWAFNNLTYLPYMTEAS
WKGNPLGDLGATTNGLFDSAGRQWRTECKTPATGGDACRSYTMTTVYAATPKAEGGYTFS
QKNEWVFNNIVMFGGPEKR

Enzyme Prediction     

No EC number prediction in MGYG000001483_03036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	49	329	2.6e-31	0.43988684582743987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18080	Gal_mutarotas_3	2.89e-41	44	268	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	3.41e-30	453	553	1	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam12905	Glyco_hydro_101	2.05e-13	269	442	1	261	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
pfam05345	He_PIG	2.29e-12	590	674	1	95	Putative Ig domain. This alignment represents the conserved core region of ~90 residue repeat found in several haemagglutinins and other cell surface proteins. Sequence similarities to (pfam02494) and (pfam00801) suggest an Ig-like fold (personal obs:C. Yeats). So this family may be similar in function to the (pfam02639) and (pfam02638) domains. This domain is also found in the WisP family of proteins of Tropheryma whipplei.
cd14244	GH_101_like	2.77e-11	362	467	152	295	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXT63218.1	2.88e-110	32	584	222	904
ASK67116.1	2.48e-83	38	584	49	723
AER04697.1	7.39e-81	33	586	205	898
ALD70844.1	5.67e-80	33	586	186	879
AEW84145.1	6.51e-80	33	586	112	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QFO_A	3.65e-17	44	578	12	754	EngBFDARPin Fusion 9b 3G124 [Bifidobacterium longum]
6QEP_A	4.78e-17	44	578	12	754	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6QEV_B	4.78e-17	44	578	12	754	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6QFK_A	4.78e-17	44	578	12	754	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
6SH9_B	4.78e-17	44	578	12	754	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	3.40e-50	29	577	39	709	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q2MGH6	7.81e-07	493	578	956	1042	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	7.81e-07	493	578	956	1042	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.470571	0.511693	0.015367	0.001486	0.000421	0.000452

TMHMM  Annotations     

start	end
7	29