CAZyme Information: MGYG000001484_00957

Basic Information

• Species: Nigerium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Nigerium; Nigerium massiliense
• CAZyme ID: MGYG000001484_00957
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	MGYG000001484_2|CGC4	82989.09	4.6951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001484	2934258	Isolate	not provided	not provided

• Gene Location: Start: 724310; End: 726577 Strand: -

Full Sequence      

MAVTGDVPATQDEQDDGWVIVEDAVPEPERVRHRETVFTIGNGAQCVRGSFEEGLAGEDP
ATFLHGVWDDEPVGMSELANLPRWIGVDVWVDGERVSLRRGVVEDYHRRLDLRTGLLTRT
ARWRANDEAPAVTLAFERFVDASRAGGSAVRVSVTADADARVRLRAPLDSHVENTGRVHF
DHVGQTSDEWAASLRVRTRATTIEVAQAAVVTLQGAGSKAWGSDADGAPAVEHECELTAG
TTAVLTKYVATIASVSSADPVGEAFGLARELADAGWAAVLAGSSAVWADRWAASDIVVDG
DPEAQIALRYNLFQLQIAAPRFTDRASIGAKTLSGFGYRHHVFWDTESFMLPLFVHTEPE
VARNMLAYRWHGLAGARAKAAANGYRGAQYPWESAGEGVEVTPTWVPDLNDRTKLVRIWT
GDIEIHITADIAFGVLQYWGATGDDDFMRDMGAEMVLDGARFWASAATLEKDGRYHFREV
IGPDEYHDHVDDNAYTNYFARWHLRAAEDVWRWLSDKHPQRAAELGEALAIDDEARASWK
TVAAGMFLPLDEKTGLVEQFEGYFALPDADIELLRSPERTESMQQIDGIEGCARTQVLKQ
PDVMMLQYLLSDEFTSAQLRANYAYYDPRTDHEFGSSLGPSISAVMACRAGDSERGYDHF
LRAARADLLDVRHNASDGIHGASAGGMWQAAVYGFAGLRLTADGFSTHPQLPASWKSLTF
TFTHRGERHTVTVTNEPEPTERTPAGPRGEDSNRA

Enzyme Prediction     

No EC number prediction in MGYG000001484_00957.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	309	702	3.2e-132	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	0.0	16	737	9	737	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	5.17e-128	16	734	8	723	maltose phosphorylase; Provisional
pfam03632	Glyco_hydro_65m	7.74e-126	309	703	1	385	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03636	Glyco_hydro_65N	4.83e-53	27	250	6	236	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
COG3459	COG3459	0.007	683	735	967	1019	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABY35234.1	2.79e-230	18	732	2	711
ACL25144.1	1.53e-229	18	732	2	710
BAJ64520.1	1.16e-226	18	736	6	723
CUS06162.1	4.73e-225	13	738	221	965
BAM01143.1	2.63e-211	18	730	224	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	9.96e-126	18	736	8	732	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	2.14e-93	17	736	13	727	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	4.15e-93	17	736	13	727	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	3.33e-82	27	720	18	711	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
7FE3_A	4.35e-49	230	721	228	665	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RBL8	6.84e-141	35	736	32	747	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
Q8L163	7.64e-141	15	736	16	750	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
P77154	1.66e-102	41	733	27	705	Kojibiose phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=ycjT PE=1 SV=1
D6XZ22	7.06e-93	17	736	13	727	1,2-alpha-glucosylglycerol phosphorylase OS=Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10) OX=439292 GN=Bsel_2816 PE=1 SV=1
Q8L164	1.85e-91	18	736	15	745	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001484_00957.