CAZyme Information: MGYG000001484_01073

Basic Information

• Species: Nigerium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Nigerium; Nigerium massiliense
• CAZyme ID: MGYG000001484_01073
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		38292.77	5.779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001484	2934258	Isolate	not provided	not provided

• Gene Location: Start: 849753; End: 850814 Strand: +

Full Sequence      

MRVVLIAHANEGVKQPFAGGLESMCWHLVQGLRERGIDVELYAGQGSDPDLRAHELPIHP
FVLSADARADVAMPPERVVSEHFAYLDLMLSLEARSDVDIVHNNCLHYLPLAMASLLPSP
MVTTLHTPPTPWLEPAARGLDDARARYVAVSEETRRAWSPIVAARTIHNGVDTRRWTLGP
GGDSLVWFGRIVPEKAPHRAIAIARAAGLRLTIAGPVWDRGYFDEAIAPQLGDGVEYAGH
LTTAELNEVVGRSAACLVTSAWEEPFGLVAAEAMATGTPAVVFDRGGLPEVVARGGGAVV
PEGDEAAAVDALRAVRRLDRRRVRDLCVRRFSLSRMVDDYVALFLEVCERGAA

Enzyme Prediction     

No EC number prediction in MGYG000001484_01073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	182	319	1.8e-25	0.89375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03802	GT4_AviGT4-like	1.65e-75	2	347	1	333	UDP-Glc:tetrahydrobiopterin alpha-glucosyltransferase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.
cd03801	GT4_PimA-like	6.20e-35	16	344	11	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.22e-27	1	351	1	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03823	GT4_ExpE7-like	4.67e-22	6	307	2	316	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03798	GT4_WlbH-like	9.12e-17	27	311	22	335	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXH97415.1	2.40e-134	1	353	1	353
QKE85823.1	6.02e-130	1	353	1	354
QDO88591.1	1.21e-129	1	353	1	353
SDO77324.1	9.53e-127	1	341	1	341
QIM21765.1	2.45e-124	1	353	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZE7_A	4.09e-23	19	334	21	338	UDPGlucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - apo form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZE7_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - apo form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZES_A UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP complex [Synechococcus elongatus PCC 7942 = FACHB-805],5ZES_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP complex [Synechococcus elongatus PCC 7942 = FACHB-805],5ZFK_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP-BH2 complex [Synechococcus elongatus PCC 7942 = FACHB-805]
5ZER_A	4.14e-23	19	334	21	338	UDPGlucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - BH2 complex form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZER_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - BH2 complex form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZFK_A UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP-BH2 complex [Synechococcus elongatus PCC 7942 = FACHB-805]
2IV3_A	7.36e-11	183	315	163	302	Crystalstructure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IV3_B Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IV3_C Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IV3_D Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes]
2IUY_A	9.86e-11	183	315	163	302	Crystalstructure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IUY_B Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY8	2.53e-14	1	315	1	355	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1
P9WMY9	2.53e-14	1	315	1	355	Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
A0QQZ8	7.33e-10	2	320	12	374	D-inositol 3-phosphate glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mshA PE=1 SV=1
B2HQV2	5.84e-09	2	312	36	395	D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) OX=216594 GN=mshA PE=3 SV=1
D2S4K7	7.57e-09	2	353	14	421	D-inositol 3-phosphate glycosyltransferase OS=Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / KCC A-0152 / KCTC 9177 / NBRC 13315 / NRRL B-3577 / G-20) OX=526225 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001484_01073.