CAZyme Information: MGYG000001484_02135

Basic Information

• Species: Nigerium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Nigerium; Nigerium massiliense
• CAZyme ID: MGYG000001484_02135
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1025		105851.22	7.4312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001484	2934258	Isolate	not provided	not provided

• Gene Location: Start: 902101; End: 905178 Strand: -

Full Sequence      

MSHPVREAGADPWAWARADETADDAASGQDAAVTAVVVTHNGARWLEDLLASLAEQTLPP
SRIVAVDTGSTDRTAALLEQALADDLLDAVVRVPEGSTVGAAARAGLELPGEPGEFVWLL
HDDVEAAPDALERLVSRLRHRPDADAATPLLVQPHRRGAPAHVSELGQTVTRSGVVRPVV
GSGTIDQGQLDSDDVLGANACGLLVRRSSWDALGGLNADVASAAQGVEFGWLAGLAGGGV
VTEPAARLVHWEASTRGIRAGAAGDPLVDRRRWGMALHEAFRGRPAGPLRVGTGSSALGR
AGARLLGKDPATAALELRALAARRRADVAVLRHRYEQLDSTPGDVGALRPTRRQELGRAS
DDLFGRVASWGAGFADGPRGASLDTLTGDEYAGGGAEDRRTPRWVVVTGLLVVAAFVAAW
RLYSPGPLQGPQLLPAHDSMGAMLGDVLDPIAGVGTSSGPPWLGLTWLASWLTLGHPDAL
VSLVLLGCVPLAFLLARRTLRRLVADRGVALSGALAYALAPILTGAVGSGQWGAVLWTLL
LPVAAHQLIDWWDARPSWSTVGAFALTATLMTAVEPLSWPLLALSVLTVCLAGRRGWLPA
LVAVASPALVAVSPWAAMVAERPGRLLTGTDPVLAPLRAPDPWQLFLARPAVEGLAPLAV
SAVAVGALWLAALIGVGRRPARASWGLALAGLGLAAAVVLTRFVVPVPPDGFARPQGTVW
LVLFLAGLVVAATTGLDGLAAGIKQRSFGGAHVALYLLRALLAVGVLAAGAWWVIGGLAP
LSRGAGVPVAPYLQRETESGLNRTLALRDDGGDVRWSLREGAGPRLGQPERGVALGGHGP
ARELAGSVAQRLATGSADDQLLADLRALGVGHVWLEGGDPELRTGIANVPGLGSGSADAT
TVTWTVPGSGRAVVVVGQTRTPVAPGALLEAGPGGRTLTLAEVPDDRWWAAVGGRRLPRA
QAADGSVSFQLPASGGVLEVGFDSAAPWWAWVQLAGLAGLAVLALPALAPQSHRPAPRRL
RRAAR

Enzyme Prediction     

No EC number prediction in MGYG000001484_02135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	35	144	1.8e-17	0.6411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	7.95e-22	35	149	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	7.85e-19	34	149	1	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	4.89e-17	32	219	4	188	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	5.58e-17	35	134	1	100	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	1.93e-16	36	219	2	133	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT08559.1	1.01e-133	11	988	67	1087
QGN31504.1	2.12e-133	11	988	22	1037
SDT20340.1	7.73e-133	11	1024	38	1092
QDP95754.1	3.92e-132	11	988	74	1107
BAK36941.1	7.39e-129	4	988	23	1098

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
404	423
474	496
508	530
561	583
596	618
654	676
683	705
720	742
755	777
987	1009