CAZyme Information: MGYG000001484_02723

Basic Information

• Species: Nigerium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Nigerium; Nigerium massiliense
• CAZyme ID: MGYG000001484_02723
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		43277.23	4.5995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001484	2934258	Isolate	not provided	not provided

• Gene Location: Start: 1516601; End: 1517731 Strand: -

Full Sequence      

MIPTESSTTDFFTVRQNDSGAWSFVDPQGEPFVSLALNHLDDSDLRYPHNVEVFEKKYGS
RKRWTEGVVRDLRDLEFNTIGWTCQYISGGWGEALDWFGDPVDLGHSAPWPDDYLLDAGL
PYVVQLRVQEIEDWNGHPAFRDVYGEDFQKYADWVARRMVSDHKNSQNLIGYFLVDIPAW
LPHASGRFWPGFDGLSAEEHETKLFEIATQYYKTVTEAIRRYDPNHLILGDRYNGNKGIP
EAVLRAMVPFVDVLSVQYFTGKTDAEYVTMISDLRHWHELTGKPVVIADIGNWVPTELNP
HRTSDMQTQAERGEDYKNGLATVMAEPWIIGWHWCGYIENLGRGWGIKDPQDEFYAEMTD
RIREANKAAKETVAER

Enzyme Prediction     

No EC number prediction in MGYG000001484_02723.

CDD Domains     

MGYG000001484_02723 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS37536.1	8.91e-255	6	374	3	374
QOT18563.1	1.95e-252	5	376	4	375
VEJ57907.1	2.09e-250	6	376	7	377
QUC14857.1	2.09e-250	6	376	7	377
QUC10455.1	3.46e-249	6	376	7	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	1.78e-14	58	366	412	739	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.78e-14	58	366	412	739	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	6.82e-09	176	368	563	757	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	1.59e-08	183	376	561	761	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	9.32e-08	9	345	488	917	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001484_02723.