CAZyme Information: MGYG000001485_00474

Basic Information

• Species: Pseudomonas_E massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E massiliensis
• CAZyme ID: MGYG000001485_00474
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38672.71	7.2265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001485	4723534	Isolate	not provided	not provided

• Gene Location: Start: 214820; End: 215866 Strand: +

Full Sequence      

MRILIIGPSWVGDMVMAQTLFQCLKSRHPDCQIDVLAPEWSRPILERMPQVRQALSFPLG
HGALELATRRRIGRSFRGQYDQAIVLPNSLKSALVPFFASIARRTGWKGELRYGLLNDLR
VLDKARYPLMIERFMALAYAPEEALPTPYPQPRLRIDPASRSAALERFGLELDRPVLALC
PGAEFGESKRWPAEHYAEVAEARIRQGWQVWLFGSKKDQPVAEAIRERLIPGLREEAVNL
CGDTSLAEAIDLMSCAGAVVSNDSGLMHVAAALNRPLVAVYGSTSPGFTPPLADQVEVVR
LGVDCSPCFQRTCPLGHYNCLRLLDSQRVVDALERMGTPEAQQMAEAD

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	70	319	4.1e-58	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02195	heptsyl_trn_II	0.0	2	336	1	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	2.63e-159	1	301	1	307	ADP-heptose--LPS heptosyltransferase RfaF.
COG0859	RfaF	2.04e-104	1	335	2	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	6.88e-100	69	318	1	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	1.75e-85	2	335	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ02724.1	4.75e-214	1	339	1	339
AOE65841.1	1.32e-212	1	336	1	336
QOU05831.1	1.32e-212	1	336	1	336
AOE71659.1	1.32e-212	1	336	1	336
AHC33113.1	1.32e-212	1	336	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	6.92e-110	2	336	2	342	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	1.36e-09	189	336	199	344	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	3.05e-07	187	287	190	285	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	3.05e-07	187	287	190	285	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	3.14e-07	187	287	190	285	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	2.72e-121	1	301	1	307	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	7.21e-117	1	336	1	342	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	2.05e-116	1	340	1	346	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P24173	1.63e-06	187	287	190	285	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	3.84e-06	187	287	190	285	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001485_00474.