CAZyme Information: MGYG000001485_00485

Basic Information

• Species: Pseudomonas_E massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E massiliensis
• CAZyme ID: MGYG000001485_00485
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000001485_4|CGC3	36524.95	9.3698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001485	4723534	Isolate	not provided	not provided

• Gene Location: Start: 227179; End: 228135 Strand: +

Full Sequence      

MKVLFLVQKDQRAILDELYRGVAAHCECDLRWLDSDDQRHLRRYFKREVDASRYDRILFF
LRFKQEIRQVGFIRSLPNLVILEHDAYQNYIPCKYTGKFSRHYRQLPWARVISSGAQVAR
RLREEGVDAHFVPKGYDQTLVGELGLQRDIELGFVGSLKSVAYAQRKAFLEALAQEENLL
ITRTESGADYNRMLNRIRFFVSADVGMGEYMIKNFEAMAAGCVLLAYDQGEEENRALGFE
DGVNLVLYRDLAELRRKLAQLREQPALAAGIAARGQALVHERYGFHSIGSQIVNCLRAPL
RPSPAPGWVARLRNRLGV

Enzyme Prediction     

No EC number prediction in MGYG000001485_00485.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13524	Glyco_trans_1_2	2.81e-09	212	283	14	82	Glycosyl transferases group 1.
COG0438	RfaB	2.60e-05	148	298	229	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	6.23e-05	2	297	33	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	0.009	216	292	282	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU16511.1	1.12e-169	1	318	1	318
AVX15352.1	1.51e-167	1	318	1	318
AWL02371.1	1.51e-167	1	318	1	318
VEF14257.1	2.15e-167	1	318	1	318
QTF56528.1	2.15e-167	1	318	1	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001485_00485.