CAZyme Information: MGYG000001485_02080

Basic Information

• Species: Pseudomonas_E massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E massiliensis
• CAZyme ID: MGYG000001485_02080
• CAZy Family: PL7
• CAZyme Description: Alginate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000001485_6|CGC7	23521.78	9.8403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001485	4723534	Isolate	not provided	not provided

• Gene Location: Start: 936771; End: 937427 Strand: +

Full Sequence      

MIDLTTWNLTLPVPAPTLTVATAAMPTLQTSYFTNTGDKIVFWAPVTGSASGTSDFPRSE
LRETLADGKARNWLYNSGLNTLKGTLSVNQVPSNGRVVVAQIHAKNAAAPLLKVVYRYAN
GTGNIDLEYRVNPADAKSPVAYTVPNVPLNKAFAYAIQMNKQGKLTVLINNTGPQISLAP
SWHGYAFYFKAGVYTLDNTGPVTEGGKVTYTRLDVSHL

Enzyme Prediction     

No EC number prediction in MGYG000001485_02080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	2	217	1.9e-83	0.9954337899543378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08787	Alginate_lyase2	2.51e-64	2	217	1	222	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHL33455.1	9.86e-119	1	217	1	217
SDU51327.1	1.40e-118	1	218	1	218
QHA83355.1	1.40e-118	1	218	1	218
BBP58748.1	1.15e-117	1	217	1	217
BBP64435.1	3.83e-116	1	217	1	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VAV_A	5.27e-53	3	217	2	221	Crystalstructure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution [Pseudomonas aeruginosa PAO1],1VAV_B Crystal structure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution [Pseudomonas aeruginosa PAO1]
2ZA9_A	9.62e-23	3	217	10	226	ChainA, Alginate lyase [unidentified]
2CWS_A	1.37e-22	3	217	11	227	Crystalstructure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7 [Sphingomonas sp. A1],2Z42_A Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1 [Sphingomonas sp.]
2ZAB_A	5.14e-22	3	217	10	226	ChainA, Alginate lyase [Sphingomonas sp. A1],2ZAC_A Chain A, Alginate lyase [Sphingomonas sp. A1]
2ZAA_A	5.33e-21	3	217	10	226	ChainA, Alginate lyase [Sphingomonas sp. A1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.982430	0.017466	0.000058	0.000028	0.000014	0.000026

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001485_02080.