CAZyme Information: MGYG000001485_02915

Basic Information

• Species: Pseudomonas_E massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E massiliensis
• CAZyme ID: MGYG000001485_02915
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819	MGYG000001485_7|CGC11	91402.21	6.4689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001485	4723534	Isolate	not provided	not provided

• Gene Location: Start: 805517; End: 807976 Strand: +

Full Sequence      

MTSPRQYVSSNTGARLKQLAARLLKNLYARAYVSLNQDKIRFDPDFYLAQYPDIAASRVD
PYRHYVFHGRREGRVGQSPTVENGDRIAALNPSRETVMVVSHEASRTGAPVLSLNLVMRL
KARYNVIAVLLGPGELSEAFAQPGVAVVNAYGLRASADHARLFMDKVCALKPIKLAYINS
VESRVVLPGLASNFVPTVSLIHEFPAYIRPKTAFLEVLYWSTEVVFSSTVIHQSAVKELP
VLADRPVHILPQGRCDLSFVPEDEPTDSTEAERLEARFKALKQEGKQIVLGAGLVQLRKG
VELFIDCALRVYERGGMDDLHFVWVGKGYDPERDIQYSAYLYDQILRAGLEDHVTFIPET
SAIEVAYEQSAMVLITSRLDPLPNVAIDAMCFGVPVLCFERTTGLTDFLERCGVQHACVA
RYLHVPELADKVIGLARDDHARLALGATLRASALDVFSMDNYIQGLEDIGNAAAVRTRQE
KADFDLITAAKVYRQDYIARHLVCKTDFDTLRTYVRAWASGVEKRKLFPGFHPGMYAQQC
ADYRPGQDPLASYLQNGRPAGVWAWDVITPDTPAAVIPAGLRIALHVHVYYVDLFEDILE
GLEGNTLQPDLFLSVPDEAIKQAATIACQRYKGTVKAIEVVPNVGRDIGPFLSGFEQRHL
LDYEIVGHLHTKKTKDYKDPMVGRIWYEFLLANLLGKSAPMADIIVSRLIENKQLGMVFP
DDPNLVGWDSNMAFARPFMAKLGLDHLPNDIVFPVGTMFWARAECMRPLLELGLCWDDYP
TEPLPFDGTMLHALERLMPMVAVAKGYTISSTNVQNITR

Enzyme Prediction     

No EC number prediction in MGYG000001485_02915.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05045	RgpF	1.12e-46	580	805	269	501	Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.
COG3754	RgpF	8.88e-36	564	808	278	525	Lipopolysaccharide biosynthesis protein [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	5.60e-18	97	469	2	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.22e-16	200	469	127	373	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	9.00e-14	97	410	2	302	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB75692.1	2.98e-250	42	819	46	828
QZP32875.1	7.72e-231	37	819	450	1236
QDV94470.1	2.41e-229	37	819	450	1236
ARP84089.1	2.87e-222	42	812	55	828
QEU30749.1	3.82e-212	45	819	32	806

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0RVK2	2.67e-19	570	811	437	672	Uncharacterized protein WxcX OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=wxcX PE=4 SV=1
P0C7J1	4.65e-19	570	811	437	672	Uncharacterized protein WxcX OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=wxcX PE=4 SV=1
O05083	2.25e-06	279	410	175	296	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001485_02915.