CAZyme Information: MGYG000001485_04301

Basic Information

• Species: Pseudomonas_E massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E massiliensis
• CAZyme ID: MGYG000001485_04301
• CAZy Family: AA6
• CAZyme Description: NAD(P)H dehydrogenase (quinone)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199	MGYG000001485_7|CGC20	20635.44	6.7601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001485	4723534	Isolate	not provided	not provided

• Gene Location: Start: 2314542; End: 2315141 Strand: -

Full Sequence      

MAKVLVLYYSSYGHIETMANAIAEGARAAGATVDVKRVPETAPAEVAKAAHFKLDQAAPI
ASVQDLANYDAIILGSPTRFGRVSSQMAAFLDQAGGLWAKGVLNGKVGAAFTSTASQHGG
QETTLFSLITNLLHFGMVIVGLPYSHQGQMTMDEIVGGAPYGATTIASGDGSRQPSEIEL
AGARHQGELVAKTAAKLFS

Enzyme Prediction     

No EC number prediction in MGYG000001485_04301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	3	196	2.8e-82	0.9948717948717949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03767	PRK03767	2.68e-135	1	198	1	199	NAD(P)H:quinone oxidoreductase; Provisional
TIGR01755	flav_wrbA	2.78e-102	2	197	1	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
COG0655	WrbA	3.30e-61	1	197	3	205	Multimeric flavodoxin WrbA [Energy production and conversion].
pfam03358	FMN_red	1.26e-12	3	144	2	143	NADPH-dependent FMN reductase.
TIGR01753	flav_short	1.42e-12	4	113	1	88	flavodoxin, short chain. Flavodoxins are small redox-active proteins with a flavin mononucleotide (FMN) prosthetic group. They can act in nitrogen fixation by nitrogenase, in sulfite reduction, and light-dependent NADP+ reduction in during photosynthesis, among other roles. This model describes the short chain type. Many of these are involved in sulfite reduction. [Energy metabolism, Electron transport]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05288.1	1.98e-50	3	195	4	196
SPT18005.1	2.26e-49	3	197	4	201
SPT16509.1	3.20e-49	3	197	4	201
CDR88365.1	4.82e-49	1	191	1	194
CCA69494.1	5.01e-49	3	199	6	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F4B_A	3.57e-74	1	197	4	200	Structureof B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308],5F4B_B Structure of B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308]
5F51_A	6.21e-74	1	197	21	217	Structureof B. abortus WrbA-related protein A (apo) [Brucella abortus 2308]
2R96_A	1.30e-68	1	197	1	196	Crystalstructure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
4DY4_A	7.22e-68	2	197	1	195	Highresolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]
3ZHO_A	7.22e-68	2	197	1	195	X-raystructure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8HRS7	6.02e-123	1	198	1	198	NAD(P)H dehydrogenase (quinone) OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=AZC_4089 PE=3 SV=1
Q1LFW3	2.06e-114	1	198	1	198	NAD(P)H dehydrogenase (quinone) OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=Rmet_4096 PE=3 SV=1
B0SZC3	2.92e-114	1	198	1	198	NAD(P)H dehydrogenase (quinone) OS=Caulobacter sp. (strain K31) OX=366602 GN=Caul_4332 PE=3 SV=1
B9M9X5	4.79e-111	1	198	1	198	NAD(P)H dehydrogenase (quinone) OS=Acidovorax ebreus (strain TPSY) OX=535289 GN=Dtpsy_0057 PE=3 SV=1
B2JML0	2.67e-110	1	198	1	198	NAD(P)H dehydrogenase (quinone) OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=Bphy_3669 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001485_04301.