CAZyme Information: MGYG000001486_01856

Basic Information

• Species: Mobilicoccus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Dermatophilaceae; Mobilicoccus; Mobilicoccus massiliensis
• CAZyme ID: MGYG000001486_01856
• CAZy Family: GT1
• CAZyme Description: L-demethylnoviosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001486_20|CGC2	40451.84	4.9592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001486	3841955	Isolate	not provided	not provided

• Gene Location: Start: 315538; End: 316692 Strand: +

Full Sequence      

MPHVAFAALPAYGHVFPLVPLALATQARGARVTFATGGELLGRLPVPTERGTDAASVGDL
VGATMSRFPAATEDMATRWVPAFFGVVHAEASLEPLRRLWSHDRPDLVVYETTHSAARVV
ADDLGIPSVMCGIGHILPMMTSLSEVTRRHLEDPSVPPWAPLDVAPPLDTYLDPMPAALQ
QGDDGSIRTRRPLRSVAWEEPRPDFVAPWGDSRRPRIYVTLGTVFSGGGWGSEDNPIVGL
VREAAQVGDVLVAVGPAGDPDTVHDPSRGIHAARMVPQATVLRQADLVVHHGGSGTTLAA
AAAGVPQIVVPQGADQFLNAAAVASTRIGLAFPGERPPGAVVDALTRLRDDDTYRAAART
VAADIAAMPDPDDVAAELVTDADR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	6	378	1.8e-32	0.9267015706806283

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	2.72e-44	2	378	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	2.73e-36	1	378	1	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	7.68e-26	9	366	3	374	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam04101	Glyco_tran_28_C	8.52e-05	281	379	68	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
PLN02992	PLN02992	0.005	182	347	271	422	coniferyl-alcohol glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXQ13040.1	2.90e-103	2	384	38	416
ASN51741.1	7.79e-89	2	379	5	383
ACV80113.1	2.19e-57	7	378	6	376
QNF44921.1	5.55e-54	6	378	5	379
QXV59837.1	4.54e-52	6	378	5	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	8.70e-46	4	374	23	399	CrystalStructure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
4AMB_A	7.59e-25	6	379	27	396	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	1.42e-24	6	379	27	396	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
6KQW_A	1.14e-21	3	335	5	337	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.20e-21	3	335	5	337	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F2F9	3.75e-30	8	380	7	371	Elloramycin glycosyltransferase ElmGT OS=Streptomyces olivaceus OX=47716 GN=elmGT PE=1 SV=2
Q9L9F5	8.95e-29	4	381	3	372	L-demethylnoviosyl transferase OS=Streptomyces niveus OX=193462 GN=novM PE=1 SV=1
A0A0H2V630	1.03e-23	4	380	3	366	Enterobactin C-glucosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=iroB PE=1 SV=2
O34539	6.55e-21	3	335	5	337	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	1.22e-18	3	354	5	361	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991898	0.008016	0.000070	0.000013	0.000007	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001486_01856.