CAZyme Information: MGYG000001486_02358

Basic Information

• Species: Mobilicoccus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Dermatophilaceae; Mobilicoccus; Mobilicoccus massiliensis
• CAZyme ID: MGYG000001486_02358
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	MGYG000001486_21|CGC3	62174.71	10.4112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001486	3841955	Isolate	not provided	not provided

• Gene Location: Start: 421885; End: 423558 Strand: -

Full Sequence      

MVVPRVRATPRTRGTTMGRHRRPRTMTSMSETDRLRARLLGHRPTDTLYGWVGAVLVAVF
GGVLRFWRLGRPETLVFDETYYVKQAWSLLTQGYEAKVLPKYASGATPKVDDVWASGTPD
VFGTQADYVVHPPVGKWVIAVGEQLLGVQNPVSWRFGVAVLGTLSILMLALAARRMFGST
VLGLSAGLLLAVDGQHLVHSRTGLLDMSVMFFALGGFCALLLDRDRSREILARRVGGHLD
AGGSLDAPMMRYGPWLGLHPWRFVAALSLGLCIGTKWSGLYFLAAFGLMTVFWDMGARRA
AGVRRWWWGAMLFDAPQAALTMVGTALITYLGTWAGWFATSGGWNRQWATNHPATGLATL
VPDPLRSLWRYHADMMSFHVKLSTPHDYQSNPWSWMLQSRPTSFYYLGPKLGDQGCAVAE
CSKAILDLGNPVIWWTATLALPVLLFMWALARDWRAGAILAGFVGGYLPWFQYQERTIFT
FYSVAFVPWVVLAVVYLLSLVLGSAEAPPARRRAGIVVWAAFMVLAIGMFAFFWPIYVAD
VIPRVDWGHRMWFRSWI

Enzyme Prediction     

No EC number prediction in MGYG000001486_02358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	57	338	4.6e-72	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.05e-24	43	557	16	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	4.11e-16	366	554	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	9.06e-08	55	292	1	198	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	4.74e-07	131	499	136	410	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV25263.1	2.71e-235	35	557	2	525
QGN59116.1	1.03e-223	29	557	1	518
SDP39524.1	3.56e-220	26	557	1	521
QKE82522.1	2.57e-212	29	557	1	519
QDO90470.1	7.63e-209	34	556	3	517

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.83e-91	44	556	31	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	2.94e-84	44	556	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.94e-84	44	556	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.28e-71	49	556	36	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999477	0.000512	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
47	69
152	171
176	198
203	222
277	296
316	338
428	450
454	471
478	500
515	537