CAZyme Information: MGYG000001487_00725

Basic Information

• Species: Beduini massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Beduini; Beduini massiliensis
• CAZyme ID: MGYG000001487_00725
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000001487_3|CGC4	41822.72	5.42

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001487	2850586	Isolate	not provided	not provided

• Gene Location: Start: 378519; End: 379610 Strand: +

Full Sequence      

MRRLGISIYPEHSTKEKDFAYMEMAAKYGFSRIFTCLLSVNKPKEEMIEEFKEFMDKAHE
LGFEVAVDTNPKVFEHLGASATNLKPFADMHVDIVRLDMSFGAMMDTMTTQNPYGLKIEF
NGSTTSDNVEAMLHMGARQDQMLICHNFYPQKYTALDWDLFMSFSRNWRRLGFTTAAFVS
SHNDPTFGPWEVYAGLPTCEMHRKLPIDLQARHLFATGLIDDVIIGNAYATEEELKALGS
IDLNTVQIKIDLADTVTEEEKNLLFNHVHSNRGDYPSQMVRSSFTRMLYRETSIPHTPCD
KEFFTRGDVCVINDNLKHYRAEVQIILEDIPNDGERNLVGRIPEEELCILEHLKGWKKFN
FIK

Enzyme Prediction     

No EC number prediction in MGYG000001487_00725.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	3	361	8.9e-116	0.9942857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	6.41e-108	4	239	1	234	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	6.40e-99	1	363	1	358	Uncharacterized protein [Function unknown].
pfam05913	DUF871	3.45e-37	246	362	1	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
cd00551	AmyAc_family	0.001	48	99	75	118	Alpha amylase catalytic domain family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; and C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost this catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG2200	EAL	0.004	48	107	135	187	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) [Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCZ49101.1	1.02e-157	1	363	1	362
QAT39807.1	2.46e-156	1	363	1	362
QNM14116.1	4.36e-147	1	354	1	353
QJA01274.1	2.08e-140	1	363	1	364
QIX07901.1	1.69e-139	1	363	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	3.54e-115	2	363	27	385	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001487_00725.