CAZyme Information: MGYG000001488_02532

Basic Information

• Species: Risungbinella massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Thermoactinomycetales; Thermoactinomycetaceae; Risungbinella; Risungbinella massiliensis
• CAZyme ID: MGYG000001488_02532
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		28963.49	10.6043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001488	3420920	Isolate	not provided	not provided

• Gene Location: Start: 261569; End: 262315 Strand: -

Full Sequence      

MGTGPRNPSLSQRQGISIISCTNRPSYVKNLVQNYVRQAHPKKELIIVVNSNDTSLSPYY
RLTQKLRNVRIFRIPEHETLGACLNFAVNKASYPYIAKFDDDDYYAPYYLAEMLQTLKRK
NADIIGKRAHFMYLRGSKMLLLRFPQDENREVTYLPGATLVFKRSVFKRIQFPNRNIGED
DLFCLSGKMEGYKVYSAGKYNFVAIRRKNSANHTWIISDKELLSHHKKIPHVRNYKRFVS
RKPKGFRS

Enzyme Prediction     

No EC number prediction in MGYG000001488_02532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	18	159	5.9e-18	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	2.02e-07	18	209	7	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam00535	Glycos_transf_2	3.43e-07	18	167	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	3.51e-06	18	195	59	255	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd02525	Succinoglycan_BP_ExoA	1.02e-04	18	195	5	198	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd00761	Glyco_tranf_GTA_type	1.05e-04	18	162	2	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU16798.1	1.17e-124	1	244	1	242
AFC34004.1	4.91e-124	7	247	4	245
AFH66332.2	4.91e-124	7	247	4	245
AIQ11089.1	4.51e-122	1	245	1	243
QQZ62517.1	2.11e-121	12	245	10	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001488_02532.