CAZyme Information: MGYG000001489_01375

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_01375
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000001489_1|CGC33	86229.21	5.2447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 1782159; End: 1784444 Strand: -

Full Sequence      

MKRYFVYLFFYSFISCHLSVEDKVYNSGIHIIPEPLQLEVRQGVFPVSNSTTLSLENGDW
EKEASVLMNKLEEASGYKLSFSDNSSNNCIRFKTNENLGEEGYEIEVDDRQISLSAATEK
GMFYAIQTFFQLLPAEIESAKPLKMKLSVPAVKIADHPRFSYRGVMIDVSRHFFTVEELK
KQISVMAMLKLNRLHLHLTDNQGWRIAIDKYPQLVEYSAVQETYNEELYGPCYYTKEDIK
ELVAYADRHHIEVIPEIEFPGHSLSALVPFPGLSCSGGPFKSEQVFGYEENVFCVGNDSV
FTFMENVLTEIAELFPARYLHIGGDECVKRYWQTCPRCQALAKRLNLRPTPEHSVEEQLQ
SYAIKRMERFISGTLGKRMIGWEEILEGGLPEDATVMSWKGTECGAKAAATGHDVVMASM
ADGLYLCAAQGADEVEPAAMGGQSYLKDVYDFEPLPKELAPDKRKHVIGTQACLWSEWTP
SGELLEYMLYPRTMALAETAWTTPEKKNWDDFLRRLENMQVRLDLKGINYHIPLPEGELT
TNKVFTGDSVVLEFKNSRSLPMVYTTDGSTPDMHAPSLPERLVLHQPCTLKVCTKTASGK
LSPIRTINVDKQTPRPAVDGICNGRIHLRLANGLFKDHNDFAKAVYETDTIINSFAAYNN
NKFDFKTPGLACYSGEIEVPETGIYTFKSNADELWIAERLVICNPTSSRFYEQKTQIALE
KGVHSFDLVFSNRLKEGFATCWYPIDFQYLPPSGGEWIKSN

Enzyme Prediction     

No EC number prediction in MGYG000001489_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	155	503	9.1e-111	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	160	516	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	8.51e-147	160	502	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.12e-109	31	606	136	713	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	1.72e-98	160	516	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	2.37e-88	160	516	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDN32099.1	8.78e-241	14	759	16	784
BAD50992.1	1.64e-189	8	742	14	759
CBW24542.1	1.64e-189	8	742	14	759
QCT76325.1	1.64e-189	8	742	14	759
QCQ53669.1	1.64e-189	8	742	14	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	1.72e-128	15	576	19	582	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7DUP_A	6.47e-92	29	530	4	520	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	3.47e-91	29	530	4	520	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7CBN_A	1.21e-87	30	533	12	513	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZR_A	8.37e-83	31	533	142	640	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.91e-171	19	742	25	752	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	8.90e-87	30	533	31	532	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	9.13e-69	27	503	137	607	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q7WUL4	1.37e-58	29	531	4	478	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1
B2UP57	1.96e-54	101	537	58	482	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.171144	0.621098	0.206725	0.000349	0.000289	0.000371

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_01375.