CAZyme Information: MGYG000001489_01521

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_01521
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000001489_1|CGC37	46927.22	8.6941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 1982798; End: 1984039 Strand: -

Full Sequence      

MKILLVTRGSQGDVLPYLAVARELVKRGHEVTVNIPHVFEEIAKKYPVKVVLQDFDNIGG
MMADAAENKQSFKRIVEWTREAIDKQFVQVIPLLEQNDVLVAANTEFAATGIAAYCKKPF
VRTSFAPFLPGEKMPPPAFPYPKPNPIITPKLLWLMMNRVSNYMVKDTINKNRRKYGLAP
ISNFGEDAAKNSDNFLLYSRYLGHTDPVWDKRFRWNIGGYCFNDTFEYDEEAYQELMAFI
KKEQTPVLFFTLGSCTSNDRERFCGMLARICKRKQYRLVVGSGWAKTGETLQGNEQLFLM
QKPIPHHLIFPHCDAVIHHGGSGTTHSVARAGKPQLITPLLLDQPYWGYRVQVLGVGPER
VKIAKVSESELEQKMGDLISNPEYKKNAAMLSEQIESEKGIENICNYIESLAR

Enzyme Prediction     

No EC number prediction in MGYG000001489_01521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	90	413	1e-42	0.7513089005235603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	1.53e-50	1	396	1	390	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	1.45e-37	1	413	2	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	5.63e-20	12	397	7	376	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	7.58e-06	3	95	1	85	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
PHA03392	egt	2.57e-04	235	387	286	438	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH99441.1	2.67e-203	1	409	1	407
QJE29950.1	2.67e-203	1	409	1	407
BBK93205.1	2.67e-203	1	409	1	407
QCY58275.1	5.38e-203	1	409	1	407
QIX65162.1	1.08e-202	1	409	1	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.54e-20	5	408	24	435	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.77e-20	5	408	44	455	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	8.46e-19	1	357	1	346	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	3.48e-18	1	357	1	329	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	5.73e-10	1	357	1	335	CrystalStructure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9M8Z7	2.84e-28	1	401	193	599	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
Q9XIG1	5.35e-27	1	401	156	563	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
Q9Y751	1.37e-24	2	401	762	1167	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
Q6C8M8	1.52e-23	1	401	995	1402	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
Q5A950	2.15e-22	3	401	1017	1422	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_01521.