CAZyme Information: MGYG000001489_01726

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_01726
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1202	MGYG000001489_1|CGC46	136495.5	6.75

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 2272413; End: 2276021 Strand: +

Full Sequence      

MKKLFTLILSVLSLSIAAQTRQLSPGHPDRTAKTDLKKGFATPPKGYGEVPFYWWMGDTL
TKEHLTYHLDQMAAKKVTSLQVNYAHSDKGGVSYGLTFPSKPALFTEEWWDLFGWFMEEA
KKRNMTVSLSDYTLGVGQGSYVDDALNENPGLTGAELKFESDTIQDKYAKTCHNQLLSLY
AYQLGTDGKIIENSGIDLSGNLKGNKIEWQSPAEGNWIVTQVYSVAKKPSLDPMHPLSGK
SYVKHFFQRFEDRFPEQSKGGLNFFFSDELNFNLHGYIWNSIFRDEFRKRKGYDIVPYLT
ALFTHIGPITPKIRLDYNDVMVSLSEENFFIPVYQWHEDRNLIYGCDHGGRGKDVSEFGD
YFRTQRWNQAPGCDQPNLGKDIIKNKVASSIAHLYKRPRVWLEGFHSSNWDTNTANLTDA
TFANFVMGQNLLSLHGFYYSTMGGWWEWAPPCNHTHMPYWEEMGPFLECTERLSYILSQG
YHRADVAILYPVESVVAGYDQTAVQKAFSLGEYLYREGVDFDFMDYESLAKASIKNSKIH
ISGEEFKVLIIPSMKAIRHSSLKKALQFKQNGGIVINLGELPEATEKKGLNDPEVRSLLN
KLFGPDSKNAFVAKENQEVLDILDTNLTRDFRILSQQPQKDMPYIMHRKLGNKDLYAVYN
VPSGTECFFRATGGIELWDPWTGKTKEITASKTTDKGTIIQMPMEKQDLHLFVFDPAQKA
IIAEVPQTSVSKTILLDGEWSFDLKPSLNNKFGDFHWPATDELLGAYIYKARYNQVSSET
ADWQSPSFDDSGWKSQTFTYGTKFMILEATPELSEKELLTHLPYQSNRVQIDNKKYAWKP
YEYSWRWGVENDYGHQGWHGLKATVHDEFIRMGKLEKEFRETVRVEDPNGNKNYYLYSNV
LAPETGNYQLIFGELKPADIYINGKAVSPSTSTVTLNRGTNEIVLHYDTFGVTYCVVRKA
GDTPRILKEVTAEKPLATNFRGDLSLLPFDINKTEEPTYGQYRFTSAPGLKKLEFSAFGE
TKVWINGTLCNLSVKEKRPDGLIRYEAVMTNPSKRISTVAISIKEPWGNAGGAAIDGPIK
QTCGDGLISAGDWTQIEGLSTYSGGVWYRKNIHLEKNNGDKVYLNLGQVVSTAEVWINKQ
KAGLKLTPPWRFDITEYIREGDNQIEILLYNTAANYYLSVPTMYRGSTKAGLLGTASIEI
VR

Enzyme Prediction     

No EC number prediction in MGYG000001489_01726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	36	751	2e-87	0.8300970873786407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17132	Glyco_hydro_106	6.71e-27	196	689	354	870	alpha-L-rhamnosidase.
pfam02837	Glyco_hydro_2_N	7.62e-06	1095	1178	56	142	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
cd04083	CBM35_Lmo2446-like	2.02e-04	899	948	42	111	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	0.005	899	945	41	108	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL12449.1	0.0	4	1200	5	1200
BBL09655.1	0.0	4	1200	5	1200
BBL01784.1	0.0	4	1200	5	1200
QGY44259.1	0.0	35	1198	40	1194
QGQ95144.1	0.0	26	1200	31	1237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQM_A	1.34e-06	240	488	430	686	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron],5MQN_A Glycoside hydrolase BT_0986 [Bacteroides thetaiotaomicron]
5MWK_A	1.34e-06	240	488	430	686	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNA8	9.01e-22	1	1175	1	1093	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22040 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000932	0.998029	0.000391	0.000233	0.000209	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_01726.