CAZyme Information: MGYG000001489_02454

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_02454
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		29850.52	4.8144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 3280271; End: 3281053 Strand: +

Full Sequence      

MKKDCLLLVLIALFNLTGCERPKAPEACGPVPTEAQLKWQELERYAFIHFSMNTFTDMEW
GYGDKDPQLFNPSELDCRQWCRLFKEAGMKGVILTAKHHDGFCLWPSAYTDYSVKQSPWR
NGNGDLVRELADACKEYGLKLGIYLSPWDRNHKEYGTEAYITYFRNQLNELLTNYGDIFE
VWFDGANGGSGYYGGADETRSVDRKTYYDWPGTNQLVKKLQPDAVIFSDAGPDVRWCGNE
AGWVGETNWSTLRREEVWPG

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	34	233	3.6e-62	0.6040462427745664

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.27e-52	23	259	2	245	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.21e-34	59	222	69	226	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	6.22e-33	59	198	66	214	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZE14044.1	3.55e-140	1	260	1	258
QGY45943.1	8.26e-139	8	260	6	258
QZT35953.1	2.36e-137	9	260	7	257
QUT25677.1	2.39e-135	7	260	9	261
SCV06604.1	2.39e-135	7	260	9	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.23e-127	26	255	33	264	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3UES_A	1.51e-81	32	254	19	231	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	2.16e-80	23	250	23	240	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UET_A	1.88e-79	32	254	19	231	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	3.94e-79	32	254	21	233	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.35e-79	10	254	14	249	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.62e-73	8	260	15	256	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P17164	8.30e-11	39	155	77	189	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q9VTJ4	8.61e-11	39	149	78	185	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
Q9BTY2	2.04e-10	39	193	78	237	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000128	0.128608	0.871091	0.000056	0.000075	0.000055

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_02454.