CAZyme Information: MGYG000001489_02889

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_02889
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000001489_2|CGC4	44141.21	6.0623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 256104; End: 257267 Strand: -

Full Sequence      

MYSMSLKHMAALASLSAATLLPGNLNAQPAPVPFTEQNTATPDKQEILSIARKVADWQIK
EFSNNKYAVKEPKGWIAGALYMGMFDWAELSGDNQYFDWLKKVFNRQHWQVADRMYHADD
VCVSQTYIDMYTKYKEDKMLLPTTARIDWVINNPSNGGLDIDYSKPLSYERWSWCDALFM
APAVYTRLYTLTGNKKYMIFADAEFKATYNHLYDKDDKLFFRDSRYFGQQEANGKKVFWG
RGNGWVIGGLAEILKTLPAEDTEYRPFYLQLFKELSESLANLQNKDGFWHASLLDPDSYP
SPETSATGFIVYGLAYGVNQGYLPADKYLPVIQKGWNALVSAVEPDGKLGWVQPVGADPR
KVTREMTELYGTGAFLMAACEMYKFNK

Enzyme Prediction     

No EC number prediction in MGYG000001489_02889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	70	384	8.9e-91	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.36e-104	50	385	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.56e-54	48	384	9	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	3.17e-219	14	384	65	437
QUT74307.1	9.24e-156	44	384	25	365
ASM65072.1	1.10e-155	15	387	7	372
QUU06865.1	1.10e-155	15	387	7	372
QRP56352.1	1.10e-155	15	387	7	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.85e-72	72	386	50	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	6.86e-57	75	385	56	374	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	6.01e-51	125	385	105	357	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.09e-85	45	387	51	413	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	3.58e-74	72	387	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.24e-71	72	386	57	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	3.51e-12	75	352	31	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000393	0.998807	0.000218	0.000213	0.000190	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_02889.