CAZyme Information: MGYG000001489_03306

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_03306
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780	MGYG000001489_2|CGC11	84913.06	5.5306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 776226; End: 778568 Strand: +

Full Sequence      

MSRTTSLIIGLIAFAGHAMAQQPLYKQATAPVEDRVKDLIGRMTVEEKVGQLCCPLGWEM
YTKTANDVVASDLYKERMKTMPIGSFWAVLRADPWTQKTLETGLNPELSAKALNALQKYA
VEETRLGIPVLFAEECPHGHMAIGTTVFPTSLSQASTWNAELMHRMGEAIALEARSQGAN
IGYGPVLDIAREPRWSRMEETFGEDPVLTTHLGVAFMKGMQGKSQNDGKHLYSTLKHFAA
YGIPEAGHNGARANVGMRQLFSDYLPPFKKAVEEGVATIMTSYNTIDGVPCTSNKYLLTD
VLRDQWGFKGFVYSDLTSIEGIVGARVAKDNKEAAVLALKAGLDMDLGGNAYGKNLQKAL
EEGAITMDDLNRAVANVLRLKFRMGLFENPYVSPEQAKQVVRSKAHKELAREVAREGIVL
LKNEGVLPLKKNIGSIAVIGPNADMMYNQLGDYTAPQEREEIVTVLDGIRKAVSPSTKVN
YVKGCAIRDVTTSNIPAAVEAARAADAVVLVVGGSSARDFKTKYIGTGAADVSNDGNQLL
SDMDCGEGYDRSTLRLLGDQEKLLKAVAATGKPLVVIYIQGRTLNMNLASEKAQALLTAW
YPGEQGGAAIADVLFGDYNPAGRLPVSVPRSEGQLPLFYSQGKQRAYVEEEGTPLYAFGY
GLSYTKFDYSQLELQKGNGKDVLQTVSCTVTNTGDCDGEEVVQLYICDKVASVSQSPILL
KAFERISLKKGESKKVTFTLGEEELSLYNMEMKQVVEPGDFKVMVGAASDDIRLEGEFTL

Enzyme Prediction     

No EC number prediction in MGYG000001489_03306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	347	5.3e-73	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	6	780	8	764	beta-glucosidase BglX.
COG1472	BglX	5.74e-101	43	475	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.03e-100	125	766	78	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.11e-80	44	380	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	4.83e-58	418	664	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW35133.1	0.0	1	780	1	785
QQY39447.1	0.0	1	780	3	787
ABR38266.1	0.0	1	780	1	785
ADV43485.1	0.0	11	780	12	781
SCD22149.1	0.0	18	780	20	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	9.04e-148	21	778	3	754	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	7.04e-147	21	778	3	754	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	1.14e-142	121	769	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	2.01e-142	10	769	13	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	6.30e-142	121	769	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.55e-152	13	780	18	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	8.13e-149	13	780	18	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	3.33e-142	92	773	29	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.56e-128	25	773	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.23e-87	13	772	12	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.999023	0.000175	0.000167	0.000157	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_03306.