CAZyme Information: MGYG000001489_03658

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_03658
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		95385.53	5.9787

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 1187010; End: 1189526 Strand: -

Full Sequence      

MQILANLLLTLLLCCIPGFTYAQSLSLELYPQPQQIVISNQQYVPSHGYTLQGISNPDAD
AVKILKEALPFVQSGKSLPLEVKKLKARTPEMERSGAYILDISKKKITIEIVDDRSLFYA
AQTLKQLVGYNEAGKRTLPLCTITDYPDVLHRGTVEGFYGTPWSHDDRISQLRFYGQFKM
NTYIYGPKDDPFHSASWREPYPADQAKQIKELTTEAARNKVDFVWAIHPGQDIKWNATDS
NNVITKFEQMYDLGVRAFAVFFDDISGEGTNAAKQAGLMNFIQKEFIEKKSDIQPLIMCP
TEYNRSWARTDYLDILGEQLHPAIHIMWTGNRVVDDITLEGLEWVNKRIRRPAYIWWNFP
VSDYCRDHLLMGPAYGLDTQASNAMSGFVANPMERAEASKVALFGVAMYSWNIHSYDPQL
AWEKACEYLVPKAAIAFKTFCENNSDPGPNGHLYRREESTRYQAQADKFLTGYRNGQFGE
RDANQLGALFAQIQAAPELIYNQGDNKALIKEINPWLMQFELLGRCGSNALRMAHAWYEK
DRQNTWQRFLEVSAVMDSMKLVNRTFNQNPYQKGVKVGSRVLMPLIEGLYRQTSRNLLST
ADTPSNEIRVSTASTITNIDQLKNQPWSEDENLIAYVPMLEVVKVEPNQYLGLGWEIQKD
AESFTFNLPQSNVDGRVFEWSEDGKTWTILSDIPADRTKFTVTTIPLNAHFVRMRNNSGK
QMELKVAAFSVKTKEAPEINEELMMYDLNLSTYKTLKPGEKVEVKCNGVDKYIEFFLSGN
NDSMVSISGVNNDGENNMLYCGYVGYVKLNKISFDDMQTLIITPAGKTPVQIHQIVRE

Enzyme Prediction     

No EC number prediction in MGYG000001489_03658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	152	441	6.2e-116	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.07e-175	152	440	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.38e-14	27	145	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	1.78e-06	23	153	130	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam18344	CBM32	1.68e-04	616	653	13	50	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR50703.1	0.0	1	838	1	837
QKH97468.1	0.0	1	838	1	837
BBK91139.1	0.0	1	838	1	837
QUT54259.1	0.0	1	838	1	837
QUT95333.1	0.0	1	838	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	2.40e-198	12	729	13	730	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	1.35e-197	12	729	13	730	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	1.35e-197	12	729	13	730	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	7.71e-197	25	729	1	709	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	8.49e-197	24	729	3	712	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.31e-197	12	729	13	730	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.57e-92	28	563	45	625	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	3.00e-92	28	827	45	854	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	2.75e-58	93	692	129	752	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.91e-41	153	409	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000754	0.754129	0.244331	0.000269	0.000268	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_03658.