CAZyme Information: MGYG000001491_01512

Basic Information

• Species: Rubeoparvulum massiliense
• Lineage: Bacteria; Firmicutes; Bacilli; Rubeoparvulales; Rubeoparvulaceae; Rubeoparvulum; Rubeoparvulum massiliense
• CAZyme ID: MGYG000001491_01512
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285	MGYG000001491_5|CGC2	32581.59	6.4147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001491	2843796	Isolate	not provided	not provided

• Gene Location: Start: 479877; End: 480734 Strand: -

Full Sequence      

MVKVEWGRRIRRGVAVILILSILLFCSMSTIGGMLVDYDRLAQYETAMKVAQREGTSHLD
HRIYVDMEQMPLYISDAFVAIEDHRYDLHPGVDLVGLGRAIWQDVRQGSLVQGGSTITMQ
LARNLFLNQDKEFDRKLKEMAIAIYLEQSYTKEELLEMYLNTIYFGHGIYGIETAANFYF
DKTVQLNHPTKETISLSEAAMLAALPKAPEHYSPIKDFAKAKQRQQVVLERMEQLGYLTE
EEKNAAIHTNINIPLAKGTVMKEPPSLFIAQQEQFRIQPIHSLTN

Enzyme Prediction     

No EC number prediction in MGYG000001491_01512.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	60	233	6e-64	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	4.51e-85	61	266	1	195	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	3.10e-81	61	233	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	4.06e-80	6	285	21	294	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.88e-79	10	248	2	246	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.90e-49	62	246	66	243	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKG84271.1	3.62e-74	13	247	32	261
AYK06684.1	1.55e-73	64	254	73	263
AKF93133.1	1.55e-73	18	254	36	263
SQI52906.1	2.27e-73	64	252	72	260
QIC07555.1	4.40e-73	64	254	73	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.09e-50	55	248	13	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	4.35e-50	55	248	13	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	5.02e-39	36	252	9	222	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	1.36e-37	64	247	59	241	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.41e-37	64	247	23	205	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	9.75e-51	20	257	22	255	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	6.15e-46	55	253	56	247	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q07259	6.92e-41	64	247	49	224	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q9KNU5	2.05e-40	40	246	40	243	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
P40750	2.68e-40	54	257	68	264	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.810080	0.138057	0.023055	0.000786	0.000509	0.027517

TMHMM  Annotations     

start	end
13	35