CAZyme Information: MGYG000001492_01101

Basic Information

• Species: Enterococcus_C massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C massiliensis
• CAZyme ID: MGYG000001492_01101
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000001492_6|CGC6	34780.45	6.6766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001492	2712841	Isolate	not provided	not provided

• Gene Location: Start: 151915; End: 152841 Strand: +

Full Sequence      

MEALFPKMAVTTKYIGSAAFCDYPTITAAFQKAHSHTIFYLLPGIYQETPRLYGKEIQVI
GLGEVIIEGKLSARQKDANDKPLGTFQTATFFVNGEEILLKNLTIRNAAGPGECVGQAVA
LYLEGTKITVENCHLQGHQDTLCLGPLPESDKHGRPLQSPWREKIYEQQQTRFIQCEIEG
TVDFIFGGGNGQFMHCLLKSLKRVDSDTSNYLTAASTCKGQPGFVFENCVVVGEQPYFLG
RPWRPHAATRFSHCFFDKKLAQEGWEDWNKPEQRLTSRYAEENCWYEASPKRAAWITFKS
KEDKQDES

Enzyme Prediction     

No EC number prediction in MGYG000001492_01101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	21	301	3.8e-59	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.13e-35	21	281	10	258	Pectinesterase.
COG4677	PemB	3.13e-35	22	295	93	384	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02671	PLN02671	8.63e-35	40	284	92	320	pectinesterase
PLN02708	PLN02708	1.41e-32	21	269	251	497	Probable pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	2.67e-31	19	284	78	330	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL62636.1	1.62e-96	1	304	1	305
BBC61522.1	1.62e-96	1	304	1	305
AUJ85241.1	8.87e-86	22	297	23	298
AYJ45554.1	1.26e-85	22	297	23	298
QGN29883.1	1.43e-84	22	297	23	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.27e-16	22	281	14	261	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.40e-12	44	252	42	252	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.56e-12	22	245	43	271	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	1.65e-12	22	269	18	253	Pectinmethylesterase from Carrot [Daucus carota]
4PMH_A	1.79e-10	83	243	144	292	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZQA4	1.22e-29	26	285	59	297	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1
Q9M9W7	2.40e-27	23	286	251	486	Putative pectinesterase/pectinesterase inhibitor 22 OS=Arabidopsis thaliana OX=3702 GN=PME22 PE=3 SV=1
Q8L7Q7	2.25e-25	21	281	299	558	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q43043	4.12e-25	22	281	68	316	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9LYT5	9.59e-24	1	281	222	474	Probable pectinesterase/pectinesterase inhibitor 35 OS=Arabidopsis thaliana OX=3702 GN=PME35 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001492_01101.