CAZyme Information: MGYG000001492_02419

Basic Information

• Species: Enterococcus_C massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C massiliensis
• CAZyme ID: MGYG000001492_02419
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	MGYG000001492_7|CGC15	23481.88	5.397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001492	2712841	Isolate	not provided	not provided

• Gene Location: Start: 983387; End: 984010 Strand: +

Full Sequence      

MAVRKYKSRKKQKVRLPAILAGFLLIGLAFVFSVKSLSSPLQPLQQLIDQPEEMDRQTFI
DTLAPHAQELQKGYGILPSIILGQAGLESNFGESTLASKYKNLFGIKAFGDQKKVKLETK
EFVNEQWITIKGEFKVYSSWEESMDDHTMLFVNGVDWDPKKYEPVLAAKDYKEAAQALQE
AGYATDPTYADKIISVIEEYQLNTYDQ

Enzyme Prediction     

No EC number prediction in MGYG000001492_02419.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	64	202	1.8e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.10e-69	23	207	6	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.32e-38	48	206	312	472	amidase domain-containing protein.
smart00047	LYZ2	2.67e-35	57	206	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	2.86e-32	35	197	132	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK05684	flgJ	5.63e-31	38	197	123	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA86005.1	9.80e-97	4	206	5	205
QIT59121.1	5.65e-96	1	207	1	204
AYA34653.1	5.65e-96	1	207	1	204
QIT61504.1	5.65e-96	1	207	1	204
QZY25310.1	5.65e-96	1	207	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.24e-27	56	206	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	8.46e-21	52	206	56	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	7.16e-18	54	199	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.00e-17	54	199	1	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.82e-17	57	197	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.95e-50	8	207	2	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q2G222	6.18e-20	52	206	316	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P39046	2.93e-19	7	206	14	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
A2RHZ5	3.84e-19	5	206	14	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	9.83e-19	57	206	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	32