CAZyme Information: MGYG000001493_00068

Basic Information

• Species: Enterocloster bolteae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster bolteae
• CAZyme ID: MGYG000001493_00068
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000001493_1|CGC1	39127.68	6.0648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001493	6583702	Isolate	not provided	not provided

• Gene Location: Start: 79308; End: 80369 Strand: +

Full Sequence      

MTEPDGQNERQRQQAVRLTVAKDGSGDYDTVGAALEALGDKEGPPSCIFIKEGVYRERLE
IRRPGITLEGQSAGGTVITGGLSAGMTMEDGSKRGTFRTYSVLVDTHDFTAKNLTIENSA
GPGEAVGQALALYADGDRILLKGCRLLGGQDTLFTGPLPPKEIQKNGFIGPKQFSPRING
RHCYQDCFIRGDIDFIFGSATAYFDRCELYSAGRDTEKKGYVTAASTPKGQKYGYVFRNC
RFTGNSSRESVYLGRPWRDYARTVLIDCYLGPHICREGWHDWDKKNARSTLFYGEYGSYG
PGAEEQEAVEQGKRDHCTSRPDWVFMLTREQIQDYTMEQVLGGTDGWNPGAYI

Enzyme Prediction     

No EC number prediction in MGYG000001493_00068.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	18	312	4.1e-93	0.9270833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.92e-86	14	307	79	383	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.98e-75	19	343	3	297	Pectinesterase.
PLN02708	PLN02708	3.63e-59	19	349	244	550	Probable pectinesterase/pectinesterase inhibitor
PLN02301	PLN02301	7.07e-58	18	303	238	502	pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	2.01e-56	15	345	10	290	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP39805.1	1.72e-273	1	353	1	353
ASN95501.1	1.72e-273	1	353	1	353
QJU20267.1	9.93e-250	1	351	1	361
ANU50094.1	2.18e-244	1	353	1	352
QQR01004.1	2.18e-244	1	353	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.82e-45	20	310	7	276	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.43e-38	18	303	9	273	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	9.01e-38	28	349	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.42e-37	27	340	43	357	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1QJV_A	3.64e-33	28	349	18	339	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.13e-47	18	309	7	276	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q1JPL7	5.13e-45	18	309	247	517	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
Q43043	7.47e-44	19	303	60	324	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9FM79	1.19e-43	18	347	82	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LXD9	1.24e-43	18	309	241	521	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001493_00068.