CAZyme Information: MGYG000001493_00112

Basic Information

• Species: Enterocloster bolteae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster bolteae
• CAZyme ID: MGYG000001493_00112
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000001493_1|CGC2	39133.15	7.663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001493	6583702	Isolate	not provided	not provided

• Gene Location: Start: 136761; End: 137810 Strand: +

Full Sequence      

MGKYILSVVGANGQNNAGSKAGNDVLRVSQECGYKLIPLYESNQVRTRVQDIISGVIATY
SLRNKLVDGDIVLMQYPLNRLLMKNIFRILKRCKSKIRIATLIHDIDYLRDIPLGDKGVD
GMKVLELSLLGSSDYLICHNPFMIRTLQKEKLSVEYISLDLFDYLYDGTPATISEDKSTV
IVAGNLLESKAGYLYQIKKDKHKFALSLYGSNYAVDKMQMDNATYHGSFKPDELIANLYG
AYGLVWDGSSTETCSGSYGKYLRINNPHKVSLYIAAGIPVVIWKEAALCSLIEENALGFG
ISSLDELEEALKSHEHLYQSYRNNVLNMKEKVCSGGFLKYVLVQIDRME

Enzyme Prediction     

No EC number prediction in MGYG000001493_00112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	11	345	2e-95	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	4.73e-80	1	345	1	329	sugar transferase.
COG0438	RfaB	6.82e-05	37	334	52	359	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP39765.1	7.13e-255	1	349	1	349
ASN95542.1	7.13e-255	1	349	1	349
QIB57915.1	2.99e-247	1	349	1	349
QMW77346.1	2.99e-247	1	349	1	349
CAI34083.1	5.17e-62	1	339	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	3.57e-12	97	342	95	322	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	1.74e-08	4	344	6	324	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	1.79e-08	4	344	14	332	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	5.09e-43	14	345	11	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	3.76e-14	21	343	20	327	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B3XPQ7	2.25e-13	4	344	4	327	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	3.45e-12	4	344	9	332	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	1.93e-11	97	342	93	320	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001493_00112.