CAZyme Information: MGYG000001493_01131

Basic Information

• Species: Enterocloster bolteae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster bolteae
• CAZyme ID: MGYG000001493_01131
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001493_1|CGC11	43200.14	4.968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001493	6583702	Isolate	not provided	not provided

• Gene Location: Start: 1236596; End: 1237735 Strand: -

Full Sequence      

MRSVKLRTSDKKKVQEKLDLVIEKLMNLGGPENGEELAEGGEAIGFFKRDFGIREWDWPQ
GVGLYGLLRIMQARKNEDYKEFLYQWFKDNIREGLPSKNINTTTPLLTLAELNEYYHDQE
FETLCLKWADWLMNCLPRTREGGFQHVTSANGDRQGVRLNENEMWIDTIFMTVLFLNRMG
QKYQNQAWIDESVHQVLMHIKYLCDKETGLFYHGWTFNERNNFGGIFWCRGNSWFTLGIL
DYIDMFRGTMNAGVKEFVVDTYKAQAEALKGLQGKSGLWHTVLTDADSYEEVSGSAAITA
GILKGIRYGILDDSYLACAWKAVEAILDNIDRDGTVLNVSGGTGMGYDADHYKNILIAPM
AYGQSLTILALAEALLHLD

Enzyme Prediction     

No EC number prediction in MGYG000001493_01131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	374	1.4e-99	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.24e-87	55	364	33	339	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.08e-79	55	364	26	329	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN96412.1	7.85e-290	1	379	1	379
QRP38799.1	7.85e-290	1	379	1	379
QJU19354.1	4.36e-287	1	379	1	379
QQQ99851.1	1.23e-277	1	379	1	379
ANU45380.1	1.23e-277	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	3.27e-77	56	375	65	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.33e-74	56	375	66	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.42e-73	52	373	43	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	3.18e-19	56	373	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.33e-18	56	373	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.31e-50	47	375	23	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.74e-18	56	373	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001493_01131.