CAZyme Information: MGYG000001493_02769

Basic Information

• Species: Enterocloster bolteae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster bolteae
• CAZyme ID: MGYG000001493_02769
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000001493_3|CGC1	43931.12	5.0606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001493	6583702	Isolate	not provided	not provided

• Gene Location: Start: 9623; End: 10753 Strand: -

Full Sequence      

MKILDRYIDQLIEQSTPECPVWNIEKIREGSKSTWNYIDGCMIKAIIELFLITRNHRYLD
FADAFTGRFVREDGSIESYDPKEYNLDHVNAGKTLFDLYKLTGKEKYRRAMDTVYSQLKE
QPRTSTGNFWHKKIYPHQIWLDGLYMAQPFYMQYEAEYNGCKNCEDSYQQFLQVYGRMRD
PLNGLYYHAYDDSRQMFWCDKVTGLSENFWLRAMGWYAMALIDTMEVMPESMACQKARLN
AIYKELIDAMLPYQDQATGMWYQVVNRGGIAPNYLEESGSAIFAYAIMKSVRLHYLPEEY
FKYGQKAFDGICSTYLSEKDGSLQLGGICLVAGLGNTDMREGTFEYYMREPVVENEAKGI
APLILAYIETMFRCQS

Enzyme Prediction     

No EC number prediction in MGYG000001493_02769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	30	370	8.7e-109	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.26e-91	32	369	31	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.87e-84	35	369	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP36827.1	2.16e-290	1	376	1	376
ASN98361.1	2.16e-290	1	376	1	376
QJU22745.1	9.47e-285	1	376	1	376
QIX91776.1	3.40e-278	1	375	1	375
ANU47524.1	3.81e-275	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.56e-103	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.29e-60	22	373	28	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.69e-60	22	373	18	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.43e-09	120	311	144	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.77e-09	35	311	66	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.25e-59	22	373	28	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.68e-42	146	371	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.68e-42	146	371	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.71e-18	35	321	29	294	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001493_02769.