CAZyme Information: MGYG000001493_03270

Basic Information

• Species: Enterocloster bolteae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster bolteae
• CAZyme ID: MGYG000001493_03270
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		52995.19	8.1409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001493	6583702	Isolate	not provided	not provided

• Gene Location: Start: 570780; End: 572222 Strand: +

Full Sequence      

MSKTSRELIEFCKGKLGTPYVFGMKGQVLTEALLKQLAAENPKVYTPQYITKARSFMGKH
CTDCSGLITWCTGILRGSANYKETAREVQPIGALNEAMAGWALWKPGHIGVYIGDGTCIE
AKGINYGTVETRAQDTPWVSVLKLKDIDYSEQVCESAVPSAHPTGWFKEDGGVRFYLEPE
RYVANDWYQDKGQWFWFDGSGHAVRNNWYLYKDNWYYFGADFAMVKGLQLIKGKPYYFNR
DGQMAKLGTRFMVQVDKNGVLHFPEEESAEIPISTGGISVENGAGREPEHTSPGKTEGKN
PALAAYEGSEYTAGAVQPPVTKAGTASEADRKAGYAQGERRISDAGICLIKQFEGCRLEA
YRCAAGVPTIGYGHTAGVAMGMKITQAQAEAYLREDLRAFEKAVNKVLECSVTQNQFDAL
VSFAYNLGAGALRNSTLLKRLHAGDVKGAADEFPKWNKAAGKVLEGLTRRRMMERQLFLS

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	342	474	2.4e-54	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	1.11e-78	346	479	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	4.86e-52	341	477	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.91e-49	341	480	6	149	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.44e-47	349	479	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	2.17e-27	367	471	1	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP37306.1	0.0	1	480	1	480
ASN97883.1	0.0	1	480	1	480
QJU23106.1	0.0	1	480	1	480
QFS78430.1	3.34e-48	341	480	2	141
QFR79200.1	3.34e-48	341	480	2	141

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	7.06e-40	336	480	46	195	ChainA, Lysozyme [Acinetobacter baumannii]
7M5I_A	9.88e-34	335	480	2	155	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
6H9D_A	1.13e-26	337	480	1	148	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
2ANV_A	1.98e-26	341	480	3	146	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
3HDF_A	1.27e-22	354	479	10	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11187	8.06e-37	341	480	2	144	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P07540	1.56e-36	341	480	2	144	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
Q9T1T5	2.56e-35	342	480	3	145	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
Q37896	3.38e-35	342	480	3	144	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P09963	5.71e-26	341	480	3	146	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001493_03270.