CAZyme Information: MGYG000001494_00712

Basic Information

• Species: Mesosutterella massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Mesosutterella; Mesosutterella massiliensis
• CAZyme ID: MGYG000001494_00712
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000001494_5|CGC1	34387.44	7.839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001494	2476884	Isolate	not provided	not provided

• Gene Location: Start: 409601; End: 410554 Strand: -

Full Sequence      

MSKTVLCRLPNHVGDCMMTLPALQLLADSGFTPSLIGKRFAEDLMAGMGWRYDPIEGQVL
KDLGRVKEIAQNTGDSPRGVLFPNSFGSALLFKLGGIRSAGYPTDGRGFLLDARLAEPGI
THEVNRFFTVAREAIIAWGGTPAREKPTPQLGLKLLARHRAGARNILRDNHITEDQKFVL
LAPVARGLHKGQKKSWDHFDSLAKYIEELGYLPLALPSPHEVEEVRVSCPSARILEPTTL
GNYAALCERASLVIANDSGISHVAAGVGARQITLIGVTDPARTGPWNPAAVTLGSEGHWP
TEEEVRNTVHRILTAEA

Enzyme Prediction     

No EC number prediction in MGYG000001494_00712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	82	293	1.7e-27	0.8177777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	5.55e-28	78	305	15	240	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	1.68e-20	2	288	1	290	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.77e-17	4	300	1	247	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	2.13e-12	78	285	82	287	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	4.22e-06	176	286	183	299	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22597.1	1.84e-131	1	313	1	311
QDA55160.1	1.29e-126	5	314	4	311
QQS89241.1	2.36e-123	5	315	6	315
ANU65198.1	1.22e-100	8	314	7	310
QQQ96353.1	1.22e-100	8	314	7	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001494_00712.