CAZyme Information: MGYG000001494_02137

Basic Information

• Species: Mesosutterella massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Mesosutterella; Mesosutterella massiliensis
• CAZyme ID: MGYG000001494_02137
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000001494_7|CGC4	27487.1	10.4753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001494	2476884	Isolate	not provided	not provided

• Gene Location: Start: 936774; End: 937499 Strand: -

Full Sequence      

MTPVKKRRGILTTVFLLLIAAALLWHLFIIGEAFAYRWINPEVTPYMKLEEARLKAEKPG
VKLRHQWIPLSRMGNNIKRAVIASEDQKFLHHDGVDWDALELAMEKHIEKGKGGGGSTIT
QQVVKNVFLSHKKSYIRKGREILISLVLDYIWPKSRILEVYLNTAEFGEGIFGVEAASRY
YFGCNASQLSRSQAAFLAAILPRPKYYQVHRNSAYIQRKASRIQAYMGDTPLRAAKESVV
R

Enzyme Prediction     

No EC number prediction in MGYG000001494_02137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	64	227	6.6e-57	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	9.28e-97	27	228	21	224	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.17e-86	27	228	16	219	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	1.30e-66	64	223	12	172	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	2.11e-66	63	229	74	242	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.65e-44	64	218	1	157	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKV58497.1	4.10e-67	18	232	15	230
CAL62869.1	5.81e-67	38	232	33	230
QWT46711.1	8.24e-67	7	227	9	225
QWT47965.1	8.24e-67	7	227	9	225
AVG18411.1	1.22e-65	18	228	12	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.22e-27	67	219	22	176	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	6.15e-27	67	219	22	176	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	1.32e-25	64	210	26	173	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.57e-25	64	210	35	182	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
5ZZK_A	7.83e-22	61	241	53	246	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4G8N2	1.16e-67	38	232	33	230	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
Q7NS41	6.92e-66	18	227	12	222	Biosynthetic peptidoglycan transglycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtgA PE=3 SV=1
A6T2A4	7.60e-66	38	232	33	230	Biosynthetic peptidoglycan transglycosylase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=mtgA PE=3 SV=1
Q7WF82	1.98e-63	10	227	14	236	Biosynthetic peptidoglycan transglycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=mtgA PE=3 SV=1
Q7W039	1.98e-63	10	227	14	236	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999932	0.000041	0.000004	0.000000	0.000000	0.000044

TMHMM  Annotations     

start	end
7	29