CAZyme Information: MGYG000001495_00825

Basic Information

• Species: Anaerococcus jeddahensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus jeddahensis
• CAZyme ID: MGYG000001495_00825
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		56604.59	6.4181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001495	1903534	Isolate	not provided	not provided

• Gene Location: Start: 198412; End: 199845 Strand: +

Full Sequence      

MNRQTYIKLEKENQEFRKKVNSDPNRLKFHLMPPTGFLNDPNGLYQKDGLYHIYFQYTPF
NPGWGLKTWGHYTSSDLLTFKEEEPFLYPDINEDKDGVYSGSAFIEDGKIHFFYTGNVTY
KDMEGYDGILLGREQNTIKVTSPDGFNYDKKNIVLKNEDYPPYMSCHVRDPKIFKKDGNY
YMAIGGRMKDDVGGLLLFKSKDLENFEFFDMVTTKEKFGYMWECPDLFELDGKLVLVVCP
QGVKKDGYKYENVYQCGYFFLDYDFETKKYSLSEFKELDHGFDVYAPQSFLYEKGRRIQI
CWMGIPDAEYTNEPTVKYGWNNALSMPKELKIKNNKLIQNPIDEIKNLRLKEYFCKIDGF
EDLKIKDEIYEMKVDFEKKKDFKLEIRKNLFLEYKENLLTLTMNESGFGRDKRHIEIEKI
KNIRIFNDTSSIEIFINDGEEVMTSRAYTEKISKPRFITKNKGKIQYYPLRGYEYIK

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	341	5.2e-92	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	5.98e-151	36	334	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.07e-149	14	449	2	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.09e-132	1	448	3	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	2.45e-109	30	439	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.61e-106	30	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB72997.1	2.52e-175	1	473	1	495
AVQ19049.1	1.75e-174	1	474	1	460
ALQ40753.1	5.34e-172	1	477	1	471
CKG85342.1	2.01e-169	1	474	1	468
ALQ41936.1	2.01e-169	1	477	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	8.33e-70	29	466	29	476	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	1.76e-61	22	448	29	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	3.77e-58	18	450	40	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.43e-57	18	450	40	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	2.68e-50	29	472	6	429	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.93e-104	20	448	23	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	2.87e-81	20	451	28	466	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.56e-77	29	472	40	475	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q04937	1.23e-72	10	444	17	445	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
P40714	1.68e-69	29	450	28	451	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001495_00825.