CAZyme Information: MGYG000001497_00676

Basic Information

• Species: Clostridium_F niameyense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F niameyense
• CAZyme ID: MGYG000001497_00676
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		21508.21	10.1551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001497	2542824	Isolate	not provided	not provided

• Gene Location: Start: 501615; End: 502160 Strand: +

Full Sequence      

MKFFRRLIILVLTLIVIFNITTIAKSIFPVKHKNYIVKYSKEYNLDPYLVMAIIKTESNF
KEDAKSNKNAQGLMQLTPDTAEWIGNKMNMDYFTLDELKNPEINIKMGCWYLNNLRQEFN
GNMDLVLAAYNGGRGNVKKWLKQKEHSKDGENLHYIPFKETDKYVKKVKVRYNIYKFLYK
R

Enzyme Prediction     

No EC number prediction in MGYG000001497_00676.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	45	173	1e-30	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.95e-83	29	174	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.47e-56	28	178	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.56e-43	47	173	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.22e-38	16	179	123	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.20e-35	36	143	1	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA45057.1	3.62e-96	1	180	1	180
QMT99888.1	3.62e-96	1	180	1	180
ABS39354.1	3.62e-96	1	180	1	180
AUN00283.1	3.62e-96	1	180	1	180
APC82824.1	3.62e-96	1	180	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.05e-25	28	168	445	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.09e-25	28	168	474	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	2.67e-25	28	168	445	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	2.67e-25	28	168	446	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6CF9_A	1.11e-11	41	178	356	499	Crystalstructure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni at 2.3A resolution in I23 space group [Campylobacter jejuni],6CFC_A Crystal structure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni in complex with Bulgecin A [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	1.01e-18	31	173	1421	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.01e-18	31	173	1421	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	4.55e-17	38	168	66	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
B7LSJ1	1.93e-08	38	115	45	124	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
Q2NRB3	3.16e-08	31	146	190	314	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.592125	0.399673	0.004921	0.000742	0.000497	0.002035

TMHMM  Annotations     

start	end
7	29