CAZyme Information: MGYG000001497_01781

Basic Information

• Species: Clostridium_F niameyense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F niameyense
• CAZyme ID: MGYG000001497_01781
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	MGYG000001497_6|CGC10	28332.2	9.6114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001497	2542824	Isolate	not provided	not provided

• Gene Location: Start: 1649370; End: 1650143 Strand: +

Full Sequence      

MKKIKTLLLTSALCFTLSSPAFAADYKVLSGDSLYKVGKLFNTSSDTLIKDNNLKGTTIY
PGQVLKVPSSTYTVKSGDSLFLISKANGIKLDDLRKANNKWDNLIYPGQVLNLPGKTPNS
GNSNIENTNTEKPIINYSNEDLDLLARLITSEAQDQPYDAQVAVASVVLNRIKSSEFPNT
ISSVIYQKSDGYYQFTPVENGWIKKPATETSKKAAKDALYGADPSNGALYYFDDTATNKW
LWSKPIKARIGNMVYVK

Enzyme Prediction     

No EC number prediction in MGYG000001497_01781.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07486	Hydrolase_2	9.77e-43	156	255	2	100	Cell Wall Hydrolase. These enzymes have been implicated in cell wall hydrolysis, most extensively in Bacillus subtilis. For instance Bacillus subtilis steB is expressed during sporulation as an inactive form and then deposited on the cell outer cortex. During germination the the enzyme is activated and hydrolyzes the cortex. A similar role is carried out by the partially redundant Bacillus subtilis CwlJ. It is not clear whether these enzymes are amidases or peptidases.
COG3773	CwlJ	1.23e-36	121	255	100	240	Cell wall hydrolase CwlJ, involved in spore germination [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	5.92e-17	19	120	339	456	membrane-bound lytic murein transglycosylase D; Provisional
PRK06347	PRK06347	7.77e-14	18	138	325	476	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	8.02e-13	16	136	398	540	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ42234.1	1.83e-103	2	257	5	259
AVQ38774.1	1.83e-103	2	257	5	259
AVQ46970.1	1.83e-103	2	257	5	259
AVQ50368.1	1.83e-103	2	257	5	259
QGT42834.1	1.05e-102	2	257	5	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F55_A	2.61e-31	137	257	11	128	CrystalStructure of the Catalytic Domain of the Bacillus cereus SleB Protein [Bacillus cereus ATCC 14579]
4FET_A	2.53e-29	119	257	83	222	Catalyticdomain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis],4FET_B Catalytic domain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3V0	3.07e-29	116	257	129	259	Spore cortex-lytic enzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=sleB PE=1 SV=1
P0A3V1	3.07e-29	116	257	129	259	Spore cortex-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleB PE=1 SV=1
Q9KCE0	4.82e-27	137	255	213	328	Spore cortex-lytic enzyme OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=sleB PE=3 SV=1
P50739	1.18e-26	137	255	188	303	Spore cortex-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleB PE=1 SV=1
P59105	2.58e-26	120	257	140	276	Spore cortex-lytic enzyme OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=sleB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.998949	0.000249	0.000177	0.000184	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001497_01781.