CAZyme Information: MGYG000001497_02433

Basic Information

• Species: Clostridium_F niameyense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F niameyense
• CAZyme ID: MGYG000001497_02433
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001497_6|CGC16	42761.97	9.7771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001497	2542824	Isolate	not provided	not provided

• Gene Location: Start: 2317702; End: 2318820 Strand: +

Full Sequence      

MKISIDARGINWYKGTGIGTYTENILKYMINKNSNYFFNIYWAGGNYNNFKKHNTNILLT
SKKYSRFFEQCYFPNNINKLKPDIYHIPQNGIGLCENINCKIVVTIHDLIPYIMPETVGK
GYLNKFLREMPKIMYLSDKIITVSQHSKNDILKFFPMDEKKVKVIPLAAGKKYKPLEKNK
CLNLLKHKYKIDCPFILYIGGFSPRKNVKSLIISFSKIYNKLQNKYKLVIIGAKKDEGNK
LLELTNKLKIASNIIFTDFVPEKDLPIFYNACSAFVYPSLYEGFGLPPLEAMSCGAPVIT
SNTSSIPEVVGNSCITIDPLNTDDMINSLENLLNNEALQRKLSKNGYERSKLFSWEKTSK
LTLDLYNELYKN

Enzyme Prediction     

No EC number prediction in MGYG000001497_02433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	194	343	6.8e-40	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	2.82e-112	2	364	1	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	1.08e-61	17	367	15	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.90e-48	17	372	16	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	4.50e-37	194	349	3	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	1.96e-31	194	335	2	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA57044.1	4.61e-191	1	371	1	371
QRI53677.1	1.87e-190	1	371	1	371
ACQ54973.1	6.21e-189	1	371	1	371
APU59002.1	6.21e-189	1	371	1	371
APR01994.1	6.21e-189	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	2.79e-19	192	370	243	425	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
6TVP_A	4.46e-11	103	369	119	399	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]
5I45_A	4.51e-09	243	348	79	190	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]
5D00_A	2.34e-08	99	370	115	372	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
3S28_A	6.48e-08	150	365	529	765	Thecrystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_B The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_C The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_D The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_E The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_F The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_G The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_H The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S29_A The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26402	1.96e-21	104	332	109	319	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
Q58577	8.02e-20	85	369	91	349	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
Q59002	1.72e-16	135	366	147	381	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
P39862	1.13e-13	116	371	117	375	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
A8LDJ8	1.42e-13	192	366	240	423	D-inositol 3-phosphate glycosyltransferase OS=Frankia sp. (strain EAN1pec) OX=298653 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001497_02433.