CAZyme Information: MGYG000001498_02347

Basic Information

• Species: Bacillus_BN testis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Bacillus_BN; Bacillus_BN testis
• CAZyme ID: MGYG000001498_02347
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292	MGYG000001498_9|CGC16	33372.88	5.0044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001498	3972118	Isolate	not provided	not provided

• Gene Location: Start: 2278079; End: 2278957 Strand: -

Full Sequence      

MKKLIKWTIVIILLLMAWTVFKSFMPVSIPAEKMEDIKTATEKASQGKIQVDWKTIAAVA
AVEYDIDTLTDEQIVRIVDLFIVENEGRYSVKSIEEVAAMLDFNIRQKQELAAYEKYLAG
VGRFFVKDDTSMQTQFIASIEKAGIENYREFGVLPSVTIAQAILESNWGRSHLSTEYNNL
FGIKDHGWSGKTASLHTSEQYDRQITAKFRVYDSIDESIKDHGRFLKENPRYTKHGLFEA
ETYADQAMALQAAGYSTKENENGERIYGRQLMGIIEQYRLYEIDNDVQSANV

Enzyme Prediction     

No EC number prediction in MGYG000001498_02347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	144	280	5.3e-35	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.58e-49	129	285	39	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.24e-34	135	284	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	2.63e-28	135	277	154	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	1.78e-25	145	222	5	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.15e-24	136	280	11	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH54741.1	9.56e-88	12	286	9	284
ASV66915.1	4.74e-75	28	287	6	266
CEI72979.1	1.11e-64	42	287	46	295
QZY57494.1	1.24e-64	42	288	38	289
AVB41582.1	6.48e-63	33	289	30	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.63e-18	131	284	28	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN4_A	1.33e-16	152	292	22	163	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.83e-16	152	279	22	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	2.50e-14	122	286	50	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	2.00e-11	149	257	17	131	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.41e-22	128	284	43	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
A2RHZ5	9.92e-17	126	291	55	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	1.34e-16	126	291	55	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	6.15e-16	126	284	55	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P15931	6.29e-15	152	292	171	312	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991798	0.004833	0.003225	0.000016	0.000010	0.000149

TMHMM  Annotations     

start	end
7	29