CAZyme Information: MGYG000001499_00706

Basic Information

• Species: Muricomes contortus_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes contortus_B
• CAZyme ID: MGYG000001499_00706
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000001499_6|CGC1	49100.26	5.3417

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001499	5155658	Isolate	not provided	not provided

• Gene Location: Start: 44618; End: 45931 Strand: +

Full Sequence      

MKKIAFIGAGSVVFTRSLVRDLMTFPAFQDATIALMDIDDEKLMYAAKSVEKIIGSGNYP
AKVISTKSRIEALKDADGVVSTINIGDLAVWANDITIPKKYGVDINVGDTRGPAGIFRAM
RTLPEMLAICKDIETYCPGAIFLNYTNPMAMLCRGMQSETKVNVTGLCHSVQGTAEMLAG
WIKADMEDITYTCAGINHQAFYLDYKWKGEDAYPLIKQAAEEHYQEEIVRNEMLRHLGYY
VTESSGHASEYVAWFRKRPDLIEKYCTHGTGWNPGHYFMVKDEYEKREHTWKKEFLEWAD
NPVNLKRGNEYAANIFNAMFGDGALYKFNGNVRNFGLIDNLPEGCCVEVPVLASKGTLEP
IHVGPLPPHLALLNNVSSRIEELAVEGAITGDPQKIYQACYFDPLTSAVLSLAEIKSMVR
EMFEANKEYLPQFKYYE

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	3	179	4.5e-58	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	0.0	1	434	1	431	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	3	423	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.25e-129	1	435	3	441	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05296	GH4_P_beta_glucosidase	1.52e-67	3	430	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam02056	Glyco_hydro_4	1.28e-51	3	179	1	178	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96821.1	9.04e-243	1	434	1	437
QHT62813.1	4.65e-229	1	436	1	438
ANE45532.1	1.12e-224	1	433	1	436
QHW31407.1	2.81e-220	3	434	4	439
QHT59435.1	8.65e-220	3	434	4	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	1.94e-37	3	433	6	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3FEF_A	1.02e-36	3	414	7	429	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	1.25e-34	3	433	9	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	5.16e-25	3	430	5	478	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
7BR4_A	5.93e-20	3	222	14	246	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06720	1.53e-94	3	431	6	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	1.19e-90	3	431	6	446	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
O34645	1.13e-82	1	434	1	432	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9X4Y0	1.99e-82	3	433	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
I3VRU1	4.58e-43	4	434	13	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001499_00706.