CAZyme Information: MGYG000001499_01272

Basic Information

• Species: Muricomes contortus_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes contortus_B
• CAZyme ID: MGYG000001499_01272
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879		101104.2	4.9413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001499	5155658	Isolate	not provided	not provided

• Gene Location: Start: 341696; End: 344335 Strand: +

Full Sequence      

MIKIIDCHHSYSENNEFSWKISGDTDQAAYCVQIQNRMREIVWNSGKVESENRHNVPCTV
QLEKEEKYNWSVECWGTDGSADRIEGKTFYSGIDGWEAEWIEPNRTRKPMMDSTEPVEPV
GRGERVGDALERLDPVVYMRKCFNLDKIPEYGVIYATARGIYHIWVNGVRVSNLFAPGNT
SYNKHIDYQCYDVTKVLKTGENVIAIALADGWYTGKIGAVGIGRQFGEENAVLWQLICKD
KEKNKLVYYSDESMKWSYGALRYADLYIGEYYDAGMELIGWKHSGFDDSEWYPVNIRKYG
YQELELQSIPDIKETRTIEPKVIRTEKNEILLDAGENIVGYISFELQLQKGQIISFEHSE
TVDKDGNYLQNIIGQNKDQADYYKADRNGIAKWKPQFTYHGFRYVRVNGTDDRHPKHYQI
HVIETPMRKTADFTCSDERLNTLQENIYRSQQGNMISIPTDCPQRERVGWTGDMQVYAPT
ACYEADVEQFLRHWMRDVQNEQLEDGQVPHIVPCMPSHDIMKPAGIKGVSAAGWSDAAVI
VPWRLYQAYGDIRILEENYELMSRYMKSTENCVAEIPDNFEELTPQRQAVQKYLWNTGFQ
YGDWLMPSIQMSGRSIFEVVQQTGYVMATLMFALTTQLMSEICSVLGKEEEAKHYQELNE
NVKYAFNVEYVNEDGLITKDYQGVYVLALWTDALPEKLRGKALEHLIQLIHNNNDLLDTG
FLSVAYLLPVLQKMGRSDIANLLLMRDQCPSWLYEVKMGATTMWEYWNGYAEDGTPGDCS
MNHFAFGCVGEYLYRTILGIQAENPGFKRMKIKPDVTCGLSYAKGYFESIWGKVEVHWKK
KEGGYTLDVVIPPNTTAEVEIGRHKGIYGCGAYHIDTES

Enzyme Prediction     

No EC number prediction in MGYG000001499_01272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	323	860	5.9e-155	0.9940476190476191
CBM67	134	295	1.9e-29	0.8636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.21e-106	428	797	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.51e-41	154	316	8	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.84e-18	799	859	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.18e-16	323	413	1	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA36872.1	0.0	17	868	17	867
AYA78378.1	1.66e-224	27	867	41	889
BBI36516.1	4.58e-214	17	859	37	893
QKS44705.1	3.43e-207	16	859	30	895
ABF44215.1	2.25e-204	18	866	27	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.56e-120	88	861	260	994	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.07e-111	18	875	26	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.51e-110	13	863	49	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.50e-129	11	861	51	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.08e-119	88	861	260	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.01e-117	11	867	47	884	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.07e-68	12	863	48	908	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001499_01272.