CAZyme Information: MGYG000001499_02473

Basic Information

• Species: Muricomes contortus_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes contortus_B
• CAZyme ID: MGYG000001499_02473
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000001499_9|CGC1	95791.41	7.5015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001499	5155658	Isolate	not provided	not provided

• Gene Location: Start: 38222; End: 40711 Strand: -

Full Sequence      

MDFKYYIDQKKFRIKPAERYIRVNGWCFEKKGKPFTYESEVNGKVVESRIKKIVRPDVQS
KFNGKYSPSADTGFHIKTYVENGVTPESYRLYIRRGSYRKCIVSMDRKEIIALKDESTIS
YNIDWVHVEPLKIILSGWAVSTSGTDKVHVSVRDDMGKALKVKMQRTKRKDVEDAGLIEA
HNVECGFIVEFICDPGKCYTLVIEDGVKRKKIRLDPVKLKKYERAQRSKQFAVRFVKALN
KKNIEKGMKYLRKNGLHGLKDHILSCVNAQGKPYQQWFEENKATEADLKKQRETIFAWQP
KVSIIVPTYKTPEIFLREMIDSVRNQSYQNWELCIADGSGGDENVERILEEYAVMDSRIK
YCLLKENLGISGNTNAALDLVSGDYVGLFDHDDVLTPDALFEVASALQEYRYDILYTDED
KMTGDGSEFNDPNFKPDFSMDLFRSHNYITHFFVVKTEIIKKIGGFRSEFDGSQDYDLMF
RCIEESDKIRHIPKILYHWRIHMNSVAGDPASKMYAYEAGKHAIEEHLKRVGIEASVEHV
GLWGMYHVKYATPGDPKISIIIPNKDHIEDLDLCIKSIQKRSIYKNYEFIIIENNSSEKK
TFEYYKYLEEQYSNVKVVYWKEGFNYSAINNFGVQYAAGEYLLFLNNDTEMITESALSEM
LGICMRKDVGAVGAKLLYADDTVQHAGIVIGFGNYAGHVHVGLKRDDYGYMVRARINCNY
SAVTAACLMTKKALFEEVGGFDEQFAVACNDVDLCLKLRKADKLIVYNAFSEWHHYESKS
RGYEDTPEKLKRFEKEVEKFQKKWPEILENGDPFYNPNFAINQAPYTLP

Enzyme Prediction     

No EC number prediction in MGYG000001499_02473.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	303	462	2.8e-26	0.9823529411764705
GT2	559	738	4.7e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.88e-107	300	501	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.93e-38	560	777	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.24e-25	303	414	1	110	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.42e-25	303	502	1	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.33e-22	556	782	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71132.1	1.60e-264	20	828	20	830
CBL36811.1	3.71e-249	119	828	1	712
CBK76130.1	3.71e-249	119	828	1	712
QJU23131.1	4.65e-243	119	828	1	712
QIX91353.1	1.32e-242	119	828	1	712

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.67e-132	300	828	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.65e-92	274	821	293	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	9.53e-20	299	517	7	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71057	1.32e-11	300	515	4	227	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
A0A0H2URH7	3.90e-11	301	414	6	116	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001499_02473.