CAZyme Information: MGYG000001501_00723

Basic Information

• Species: Bacillus_J andreraoultii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Caldibacillaceae; Bacillus_J; Bacillus_J andreraoultii
• CAZyme ID: MGYG000001501_00723
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000001501_13|CGC1	36511.19	4.9476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001501	4050118	Isolate	not provided	not provided

• Gene Location: Start: 61200; End: 62135 Strand: -

Full Sequence      

MDFIKGFTFGWLSKKGDFLKEEAKESLRLLKERTNSNYVIFALAAIQDTPFSTFVNYRGD
HMVDDDELVEMIQYAKELGMKVILKPTVNCKDGSWRAHINFFDIDVPGEPTWTEWFRSYT
DYQLHYARIAEEQKCDMLIVGCEMVQSERVEKGWRKLIEEVRAVYSGLISYNTDKYQEDQ
ITWWDAVDVISSSGYYPIHDWDRQLDRIEKVVEKYQLPFFFAEAGCPSRSGSAMIPNNWH
HVGELNVEEQADFYKVMFEKTKQRSWVGGFGLWDWSARLYDESKASQDNGYAVYGKPAER
VIYKFYTSKNL

Enzyme Prediction     

No EC number prediction in MGYG000001501_00723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	4	302	2.6e-102	0.9901960784313726

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19606	GH113-like	5.77e-141	3	306	1	303	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.
cd19608	GH113_mannanase-like	2.76e-85	2	306	1	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19607	GTA_TIM-barrel-like	0.002	65	209	74	258	Putative glycoside hydrolase TIM-barrel domain in gene transfer agent and similar proteins. This domain is found in the gene transfer agent protein, such as the Rhodobacter capsulatus putative gene transfer agent protein encoded by orfg15. In the purple nonsulfur bacterium Rhodobacter capsulatus, DNA transmission is mediated via an unusual system, a small bacteriophage-like particle called the gene transfer agent (GTA) that transfers random 4.5-kb segments of the producing cell's genome to recipient cells, where allelic replacement occurs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM48369.1	2.04e-168	1	309	1	309
QNF27004.1	2.38e-167	1	309	1	309
QOS82441.1	5.02e-163	1	306	1	306
APO42884.1	7.13e-163	1	306	1	306
QGH33886.1	8.77e-163	1	309	1	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YLH_A	7.47e-170	1	309	1	309	Structureof GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLH_B Structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112]
5YLI_A	6.12e-169	1	309	1	309	Complexstructure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLI_B Complex structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLK_A Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLK_B Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLL_A Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5YLL_B Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5Z4T_A Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112],5Z4T_B Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112]
7DV7_A	1.10e-121	1	311	35	345	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DV7_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVJ_A	8.94e-121	1	311	35	345	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVJ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVZ_A	1.46e-119	1	311	35	345	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVZ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001501_00723.