CAZyme Information: MGYG000001503_00296

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_00296
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000001503_1|CGC3	70693.23	4.8849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 354062; End: 355930 Strand: -

Full Sequence      

MKIKTVIIITTLALTFSASNAQDKLSVSFDVILNGFVGDKMKASYENRILAQDAERLIEP
FTVRDEHSCWQGEFWGKWFTSAVLAYRYIPTPELADKLKQAAYGLMETQTNDGYIGNYAP
ESRLKAWDIWGRKYCMLGLIAYYDITNDEKALESAAKEANFLIKELNDKNSKIVLMGNHR
GMAASSVLEPICQLYVRTGNKKYLQFAEEIVSQWETDEGPQLISKADIPVSQRFPKPVDN
WYGWEQGQKAYEMMSCYEGLLELFRITGKEEYKEAVEKTWQSIIDSEINIAGSGSAMEAW
FSGREKQTIPIAHYQETCVTATWIKFNQQLLRLTGEAKYADEIERTFYNALLGAMKPDGS
DWAKYTPLSGQRLEGSEQCGMGLNCCNASGPRGLFTIPQTAVMQSEDGAYINFYIDGTYH
LISPENQEFAIVQNTNYPVSGKIDLNLVLEKDENMEIALRVPFWSTNYKILINGNTEYEA
KNVLPGNYTKLKRKWKNNDKISIEFEMQGKIHRSGNTHEYVAITRGPIVLCRDERIGKPA
LEAILTPIINEKGIIDLVKEESSDPEVYMIFSAQFIPESYTEQGSQPIKVNLCDYASAGN
SSYSFPFFKVWLPQLYNPRNQD

Enzyme Prediction     

No EC number prediction in MGYG000001503_00296.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	75	531	1.9e-61	0.8912213740458015

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.03e-67	70	531	55	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.34e-55	24	531	11	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	2.95e-04	145	283	426	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	3.43e-152	33	614	29	608
AWW31219.1	3.22e-40	34	591	50	625
CEP77739.1	2.60e-38	17	538	12	542
QGH34297.1	4.05e-38	77	534	78	558
AGA77968.1	1.84e-37	34	576	50	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.90e-36	111	533	119	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.04e-30	47	568	44	613	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.99e-27	47	568	44	613	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	7.50e-24	89	613	156	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.16e-22	77	534	80	569	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.33e-22	77	534	80	569	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.999013	0.000166	0.000181	0.000159	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_00296.