CAZyme Information: MGYG000001503_00310

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_00310
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000001503_1|CGC3	86020.64	5.0376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 377586; End: 379934 Strand: +

Full Sequence      

MNKLLHLIIILFLCTVSRNLLSQELYKDPDRTTDERIADLLSRMTTEEKIGQLCFPTGWE
MYRKIDDHTAVPAESFIERMQKTPIGGFWATLRADPWTQKTLSNGLNPKLSAKALNSLQR
FAVEETRLGIPLLFAEECMHGHMAIGTTVFPTGLGQGSTWNPQLIQEMAGVIALETRLQG
AHIAYGPILDLARELRWSRVEETFGEDPVLTAKLGVAFVNGLQGNDFKDGRHVYSTPKHF
AAYGIPSGGHNGQQAFIGERELFSNHLLPFGKVAEAGVKTIMTSYNSIDGIPATAHKYLL
KDILRVEWGFDGFVFSDLGSIEGIAGTHRAAKSVKHAAALSLKAGVDADLGGNAYSKNLI
SALDEGLVSMSDIDNAVVNILRLKFEMGLFENPYVDTIKASQKVRNEKHIKLSREVARQG
IVLLKNCNNILPLKKDIGSIAVIGPNADNIYNQLGDYTAPQERSNIVTVLDGIKNAVNEK
TSVYYTKGCDIRDTTETNIQEAVDIANKSDVVILVVGGSSARDFKTEYIETGAATITGAV
NEKISDMESGEGFDRSSLDLLGDQEKLISEIANTGKPLIVIYIQGRPLNMNNASEKAAAL
LSAWYPGQEGGNAVADILFGDYNPSGRLPVSVPRSVGQLPVYYSLGRQADYVEESSSPLY
PFGYGLSYTNFEYSDLEVNNENNIIKVRCTISNIGNFDGEEVVQLYIRDNISTVYTPPIQ
LKDFKKINVKKGEYETVEFILSFDDLALYDSNMMRVVEPGEFSIMIGSSSNSIHLKGNFT
ID

Enzyme Prediction     

No EC number prediction in MGYG000001503_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	124	349	1.1e-66	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	20	781	18	764	beta-glucosidase BglX.
PLN03080	PLN03080	3.20e-94	127	773	78	775	Probable beta-xylosidase; Provisional
COG1472	BglX	1.29e-92	44	491	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.58e-82	45	383	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	4.70e-76	421	668	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA16337.1	0.0	1	782	1	782
SCD22149.1	0.0	1	782	1	782
BAR50942.1	0.0	22	779	16	773
AEW21061.1	0.0	22	779	16	773
BAR48244.1	0.0	22	779	16	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.35e-147	26	780	7	753	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.05e-146	26	780	7	753	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	2.87e-140	32	770	1	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	5.02e-140	28	770	29	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.58e-139	32	770	1	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	9.73e-144	21	781	19	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.97e-142	21	781	19	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.29e-138	127	776	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.07e-122	26	770	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
D5EY15	7.13e-88	107	776	26	855	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999187	0.000165	0.000139	0.000133	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_00310.