CAZyme Information: MGYG000001503_00412

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_00412
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		35798.97	5.0487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 496433; End: 497368 Strand: +

Full Sequence      

MFTKNQCGMIDSYKIIACVFLISLLASCTIKNREQLVDNESEFHGEFIENFSDTVSNFFR
HGTGGKGADFTWKMGVSSSSETDTKVLSFKIDPEDAAGAGKGPEIISKKFTSYGTYAARL
KIPDPKNIQPNVGAVVGYFTYRVDSIYGQSEVDFEWLISDPRVIYIGTWTGQRDNSQRIG
RTINLAEGIIYDSSYRKRDGSDRMNFTGDQNQPEQIDPIENYDASSQFYTYGFDWHPDHI
RWWMIHPITSDTVVLWNYQGSDIGIPNTHTRYRMNFWHTNNWPVHTNPSSIEKPIYPFEL
EVDWMLYKPME

Enzyme Prediction     

No EC number prediction in MGYG000001503_00412.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	4.42e-17	82	305	35	207	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02175	GH16_lichenase	7.66e-09	104	309	59	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
pfam00722	Glyco_hydro_16	1.19e-04	102	243	22	119	Glycosyl hydrolases family 16.
COG2273	BglS	0.002	43	242	53	208	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA16211.1	7.22e-238	1	311	1	311
SMD43921.1	1.46e-132	37	311	18	292
QHT65269.1	4.83e-131	19	311	4	292
QDH80247.1	2.35e-129	44	311	25	293
QIA10020.1	4.41e-129	15	311	6	293

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000020	0.000285	0.999729	0.000004	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_00412.