CAZyme Information: MGYG000001503_00460

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_00460
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	MGYG000001503_1|CGC8	77954.02	4.4951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 561903; End: 563954 Strand: +

Full Sequence      

MKFVRNIFLAGLSALLVCSCSNAPTMVENGNMVFEISEDMQTRLTWNESTNQLVDFGYTE
ALITGNDEEIKEFTLIKSSKRKINDEKGQGENYLYQGKNTEGKLTKILSVTKYEDFPNML
ITKVSFVNDGDTPVVVKEIKNNRYEVIGGGDTPTYWSFQGESTSRRRDWILPVVENFYQR
NFMGMNNSDYGGGIPVTALWRSDLGIAIGHVSLHPELVSLPVDNRNETGNAIISMTKTYE
EDEYVTLMPGETISSIEGFVQMYEGDCFLPLRRFSEYMQKSGIVMPESEPDAFESMWCSW
GYERTATFEEVLGTLPKVKELGIKWATVDDGFQIAEGDWDLDPKRFPGGDQEMIDLVKEM
KKDGLKVQLWWAPLAADPGTKILEEHPEIVMLSKDGKPYNISWWNSYYMSPVAEATINET
RKLVNRFIKEYDFDGLKLDGQHLNAVNPDYSQANHPHDPELAVRELPNFFKLIYEDALAI
KPNAVIQNCPCGTCMSFYNMPYANQVVSSDPTSSWQIRSKGLVYRAIIPKTAYFGDHVEL
SDNGDDFASSFGIGAVLGTKFTYPKNNPNVKEDYLLTPEKEVIWKKWFSLYDEKMLSTGT
YMGGLYDIGYFKPEAHVVKKDDKMYYAFYADEWDGEIELRGLEKDREYTVVEYANDEQRT
YTVNGSNPIIKPAFKKDYLIEVY

Enzyme Prediction     

No EC number prediction in MGYG000001503_00460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	227	515	1.8e-34	0.41569767441860467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.22e-45	296	593	5	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.93e-11	297	440	5	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	4.41e-09	297	539	296	533	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	1.10e-08	307	544	56	293	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14790	GH_D	7.51e-05	297	377	5	86	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM62266.1	3.20e-241	26	683	20	677
ASV29186.1	3.28e-237	21	682	26	682
BBL06940.1	6.73e-215	12	682	7	667
ARU29327.1	1.72e-204	1	681	1	685
APF18420.1	6.44e-202	6	682	2	679

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR5	6.88e-64	105	680	129	690	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1
Q92457	2.35e-06	247	388	300	455	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_00460.