CAZyme Information: MGYG000001503_00499

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_00499
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		78587.9	4.8219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 618668; End: 620728 Strand: +

Full Sequence      

MKKATLLFTILTLLFSLCITAQNNVKVTIVDRPDKNIQNNNYITNKAPLQPLSFIKLPVG
DVKPEGWTLKLLELQKDGLNGHLGEISAWLDKENNAWLGTGTDYGWEEVPYWLKGYGNMA
YILNDKDMIAETKTWLEAVFSSQREDGYFGPYIEKNGKPDLWGNMIMTWCLQSYYEFSGD
ERVIDLLTNYFKWQLNLPEDMFLKDYWENSRGGDNLLSIYWLYNITGDDFLIELAEKTHK
NTANWRQRSTLPNWHNVNIAQSFREPASYYMLSADSADLISTYNVHHLIRNTFGQVPGGM
FGADENARMGYIDPRQGTETCGFVEQMASDEILLRLTGDPFWAEHCENVAFNSYPASMML
DLKSLRYITSPNHTISDSRNHHPGIDNRGPFLAMNPFSSRCCQHNHGQGWPYYIEHLVLA
SPDNGIAIAMYGPCTANVTVADGKEVKIVEETNYPFEESVKFTIQTNGKVTFPLYLRIPT
WTENPSISVNGVKLQILMENGKYARIEKEWQNGDEVVFDFPMKLSQSVWQVNQDSRSINY
GPLTFSLKIKENYEKVSSIETAIGDSKWQKDADQEKWPSYEIYPGSDWNYALEIDESLPL
EKNFKVVKTTWPADNYPFTTESAPIQIIAKGKRVKGWEIDQYGLTAELPIKEEIKFEKES
EAITLIPMGAARLRISAFPVYLKNVE

Enzyme Prediction     

No EC number prediction in MGYG000001503_00499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	318	545	1e-32	0.42366412213740456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.40e-119	24	546	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.86e-24	319	543	292	498	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV84456.1	3.04e-170	42	679	32	647
SLM00256.1	3.04e-170	42	679	32	647
ATO82848.1	3.04e-170	42	679	32	647
ADO72059.1	1.02e-168	42	679	35	650
BCJ47054.1	3.89e-167	42	679	30	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.14e-18	319	559	333	573	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.55e-17	319	559	381	622	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	5.30e-16	319	559	333	573	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001485	0.503571	0.494096	0.000358	0.000260	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_00499.