CAZyme Information: MGYG000001503_00992

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_00992
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000001503_2|CGC1	86237.62	6.2652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 39151; End: 41490 Strand: +

Full Sequence      

MKKLFCIIILAGLFSQNNIFSQNITLNKNNIDEVINAMTLEEKVRMVIGCGMSGPDAKFP
GTAGRSYEIPRLGIPSVYFADGPHKLAMSVRREFDSNFYYTTEFPSGSTVAATFNPNAAY
EVGKAIGTEVKDYGMDVLLAPGVNLMRNVLCGRNHEYYSEDPLIVGKIAAAYINGVQSQG
IGTSIKHFAANNQETNRYSNDPQMDQRTLRELYLKGFEIAIKESSPWTIMTAYNKINGKH
TSENIDLTTTILRDEWGYNGLVISDWNAGSDAIASMIAGNDMLQPGQERQYNAIYEAVKN
GQLEEKILDRNIKRVLELVVKSNTFNNKSYPNETDLKAHAAISRKVGTEGIVLLTNNGVL
PFSEKVNQVALYGSTSYDMVPAGQGFGSLAFGRYTVSLVEGLRNANYEVDKNLIRKYQTH
LASEEKRLFPNGRPPFSLAPPPRADEFIPTAEELAEQVKSNDVAIFTIGRASSEPVDRHV
REFYLTENELALLKAVSDAYHSAGKKVIVVLNICSPVETASWKSLADAIICAFQPGQEVG
HCVTDILIGKVNPSGKLPVTFAINYGDAASDKNFPFDYEFKMPSFFMGSGLSIQGENEEP
QEVKPVRNIDYTVYEEGIYVGYRYFDTFNKNVSFPFGHGLSYTTFNYNVINSSVNDDICS
VEVTVTNTGNVSGKEVVQVYITAPEGGLKKPSKELKAFGKTRELNPGESETLTLTWKTMD
MSSFNDKSSSWELAKGKYLWHIATSAADVKSTVEHKINSSKKIKVNDVMKPAQKIATIR

Enzyme Prediction     

No EC number prediction in MGYG000001503_00992.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	283	1.8e-67	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.68e-74	38	379	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	4.82e-64	1	751	1	759	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	7.07e-39	351	622	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	5.17e-37	71	318	63	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.15e-37	34	698	56	725	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA15674.1	0.0	1	779	1	779
QUU01392.1	0.0	4	776	8	781
QUT37185.1	0.0	4	776	8	781
QUT61357.1	0.0	4	776	8	781
QQA29846.1	0.0	4	776	8	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	5.01e-206	31	750	4	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.02e-205	31	750	4	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.44e-121	30	778	4	697	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.23e-106	35	749	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	2.23e-75	26	757	1	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	7.89e-121	30	778	4	697	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	8.58e-102	38	753	12	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q5BFG8	2.27e-101	31	754	11	835	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
E7CY69	6.38e-101	38	753	12	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	4.63e-93	31	753	46	741	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000487	0.998730	0.000266	0.000161	0.000166	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_00992.