CAZyme Information: MGYG000001503_01090

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_01090
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000001503_2|CGC3	99746.24	4.5432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 144035; End: 146608 Strand: +

Full Sequence      

MRKIIILLLFTIPTLLMAQQSEVLQLNEGWQFSQVADTNQNKENVSWNDAEVPGSVQRDL
IRLGVLPDPYYGTNEKLIQWVEDKNWDFRKTFVVTAEQLQYDDAVIFFEGLDTHADVFLN
GSRILQTENMFIGHKVSVKNMLREGENKLYIRFYSPIERMMPARESFGYEYPAGNDHRDE
KLSVYNRKAPYHFGWDWGIRIVQMGIWKPVSLHLYNSASIEDYYVKQVSIDSELAETEHQ
VELFSYNEKQIEATLSIEYSVDDNINFIEEQVGLMPGWNNFSIPLKINNPKLWMPVNWGD
QNMYDFKVKLTVDNEVIAEKTVRTGLRSIRHIFEEDEHGKSYYFEVNGIPIFAKGSNYIP
GEILTTQQDEEYYERFFDNLAGANMNFVRVWGGGIYENEEFYRQADERGILVWQDFIFGC
VAYPSDDNFLANVREEAIYNIKRLRNHPSLAYWCGNNEVWEGLNFWGWGKTVPKEIMDGW
FKGYDLTFRELLPSLVSEYDGTRDYVHGSPDVANWGRPDLFNTGDVHDWGLWYGELPFEA
MADRLPRFASEFGFQSFPEMKTIKTFAKPDQWSLESEVMTIHQKASTGNSLIKKYMDMYY
HEPKNFEDFVYIGLVMQGNGMEESVEAMRRGRPYCMGALYWQINDSWPVVSWSSIDYYNN
WKAQHYRMRDVFAPLALGIENKDGNLNFYTMSDYLENRSDLILTVQIVDFSDGVKQEFKD
IVDAEANSSKIVKTVKISDIVGESEKSHTMIHAYLRDSEGNIISTKDYFFYWPNKLDLPE
TEIESSVSYKDGEYVVTLSSKKLAKDVFVEIPVLGAQFSDNFIDLLPGEERTIVITSPEL
KGADKTPVTFRHVRETY

Enzyme Prediction     

No EC number prediction in MGYG000001503_01090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	18	800	1.1e-100	0.7792553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.77e-98	21	837	10	786	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	9.66e-17	780	855	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.73e-14	218	327	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	1.86e-13	684	770	1	86	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	4.72e-07	205	458	169	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA15591.1	0.0	1	857	1	857
SCD20892.1	0.0	1	857	1	852
QRX63975.1	0.0	1	857	6	854
BBD45688.1	0.0	1	857	1	852
SCM58230.1	0.0	1	857	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.66e-316	21	857	6	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.93e-316	21	857	8	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.07e-316	21	857	8	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.08e-315	21	857	6	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	4.83e-314	21	857	6	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	4.74e-121	23	836	6	839	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q0CCA0	1.90e-120	26	853	9	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	1.02e-119	26	844	9	833	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	1.23e-116	26	835	9	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	1.71e-116	26	835	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000505	0.998489	0.000361	0.000189	0.000201	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_01090.