CAZyme Information: MGYG000001503_01333

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_01333
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		23282.56	9.8375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 419979; End: 420581 Strand: +

Full Sequence      

MKRTNNQIFFNEIAKTLFNRQLTSSQKAGIRQKLKVFDKYDITDNRWRAYMLATSYHETG
RTMQPVEEIGKGAGKPYGKKIKYDGTRYSTPDRIYYGRGDVQLTWYENYEMMGRLLNMPL
LNQPELALKPEISARIMIEGMTRGISNRGDFTGVSLENFFNNRRDDPYNARKIINGLDQA
NIIAGYYFKFLEAIEIAELN

Enzyme Prediction     

No EC number prediction in MGYG000001503_01333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	43	136	9.8e-17	0.4069264069264069

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00182	Glyco_hydro_19	7.54e-06	91	133	103	146	Chitinase class I.
cd00325	chitinase_GH19	9.09e-06	51	126	52	136	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
COG3179	COG3179	2.98e-05	35	176	29	185	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA15296.1	5.76e-141	1	200	1	200
CEA17011.1	8.15e-99	8	194	5	191
QRX62884.1	1.95e-92	5	197	2	194
SCM55308.1	7.92e-92	5	197	2	194
QRX62908.1	9.20e-91	5	197	2	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	6.81e-06	41	126	40	122	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O22841	9.34e-08	37	133	128	219	Endochitinase At2g43620 OS=Arabidopsis thaliana OX=3702 GN=At2g43620 PE=3 SV=1
Q06209	4.65e-06	49	126	123	196	Basic endochitinase CHB4 OS=Brassica napus OX=3708 PE=1 SV=2
O22842	4.87e-06	49	129	139	212	Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1
O24658	6.20e-06	49	126	119	192	Endochitinase At2g43590 OS=Arabidopsis thaliana OX=3702 GN=At2g43590 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_01333.