CAZyme Information: MGYG000001503_01403

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_01403
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000001503_2|CGC13	46104.1	5.293

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 511475; End: 512677 Strand: -

Full Sequence      

MKRLFILISILLIVSFSCSETGDEIVGEPNEDNLTLLYLADKNATYETKALYSNLWEIQK
SGFMFGHHDDLWYGRKWYNVPGVSDTRDVCGDYPAVFSVDFGSVMDDRYSYEFDINENMI
RKRVIREAYDRGEVITACIHINNPLTGGDSWDNSRKDVVKEILNEGGETNIKYKVWLDRL
AQFAMDLKGSDGKLIPVIFRPYHEHTQTWSWWGRSCTTESEFVRLWQFTISYLRDTKGVH
NFIYAISPQMDSPKGRSDFLFRWPGNEYVDFIGMDCYHGLNPTTFAINMTALSKLSKELK
KPCGVTETGVEGLIDGSGKTQYRYWTEQILTPSLGQSVSMIVMWRNKYDPNEEGHHFYSV
FKGHATESNFISMYDHPASFFSKDLPDMYIMAKGIAVEGY

Enzyme Prediction     

No EC number prediction in MGYG000001503_01403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	41	364	3.6e-58	0.9273927392739274

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.59e-30	41	277	2	230	Glycosyl hydrolase family 26.
COG4124	ManB2	3.63e-14	70	355	56	349	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99613.1	5.75e-200	2	398	3	394
CBK67266.1	5.75e-200	2	398	3	394
QGT72560.1	1.65e-199	2	398	3	394
QUT31668.1	1.65e-199	2	398	3	394
QUT88729.1	1.62e-184	1	398	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.01e-70	45	389	9	343	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	1.28e-62	39	389	33	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	1.28e-62	39	389	33	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	2.29e-62	39	389	56	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	9.83e-62	39	389	33	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	1.20e-45	8	346	18	362	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	2.91e-36	39	375	42	388	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	6.98e-14	73	309	66	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	1.21e-08	39	330	146	434	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	1.39e-07	39	315	174	430	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000087	0.999950	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_01403.